PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.20099s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 314aa    MW: 34626.6 Da    PI: 7.1
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.20099s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601391.6e-4371061100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC+++Cv+apyfp +qp+kfa+vhk+FGasnv kll++l  ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q
  Cagra.20099s0001.1.p   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFAYVHKVFGASNVAKLLNELASNQREDAVNSLFYEAEARLRDPVYGCVGLISILQHRLKQ 95 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+++l+ +k+ 
  Cagra.20099s0001.1.p  96 LQHDLENAKKD 106
                           *****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381554.6E-1124310IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.7856107IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MASSSSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFAYVH KVFGASNVAK LLNELASNQR  60
EDAVNSLFYE AEARLRDPVY GCVGLISILQ HRLKQLQHDL ENAKKDLATY VGPQAMLPIL  120
QPPQPHFMSL PPQPQRPSSS SASVLTQHHH NLLPMMAIPT GQLYQQQQQI FEAQQLAAVA  180
REQQNDMFRA YGGGSASPHH QNQAQAEILR FNSGFDSVPA GSVTVTGFNQ LSPGGTAVTG  240
MSLGGNFVDS PSTNNNYHTD QQLHHHHQQQ QHHEAQLFIP TQSSQPLPLQ TQETQTQTQQ  300
NSESEEGRRS VIG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankBT0440580.0BT044058.1 Arabidopsis thaliana unknown protein (At5g66870) mRNA, complete cds.
GenBankAB4738340.0AB473834.1 Arabidopsis thaliana ASL1 mRNA for ASYMMETRIC LEAVES2-like 1 protein, complete cds.
GenBankAB1643030.0AB164303.1 Arabidopsis thaliana ASL1 mRNA for ASYMMETRIC LEAVES2-like gene 1 protein, complete cds.
GenBankAB0107000.0AB010700.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MUD21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280835.10.0hypothetical protein CARUB_v10026811mg
SwissprotQ9FKZ30.0LBD36_ARATH; LOB domain-containing protein 36
TrEMBLR0GRB40.0R0GRB4_9BRAS; Uncharacterized protein
STRINGAT5G66870.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-161ASYMMETRIC LEAVES 2-like 1