PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1961s0053.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 467aa    MW: 51977.9 Da    PI: 5.4422
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1961s0053.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.23.2e-07152212161
                          XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                          e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++
  Cagra.1961s0053.1.p 152 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLET 212
                          78899*****************************************998887777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001703.3E-7152214IPR004827Basic-leucine zipper domain
SMARTSM003383.2E-9152216IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.036154217IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.1E-7156222No hitNo description
SuperFamilySSF579592.53E-6156211No hitNo description
CDDcd147022.52E-12162208No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MELEPISSCC SSSSSSGEDT AAANMTELEA AEALADLAQL AIMREQVFES ASSWGSKGKR  60
VRKRVKTESP PSDSLLKPPD SETLPTPDLA EERLMKEEEE EEEVQPVIKE VTKAPVKTEM  120
NGETLKPNLA STIRCSRSNG CGRSRQNLSE AEREERRIRR ILANRESARQ TIRRRQAMCE  180
ELSKKAADLT YENENLRREK DWALKEFQSL ETMNKHLKEQ VSKSVKPDTK EPEEPPKPSQ  240
VEMSTSSTPF YFYNQNPYQL FCWPHVTQSS NAMISPLEFA TSGGAAKTIT PQEHEDPADD  300
NGQKTHFYVV PCPWFLSPPD QSNGVSLGDQ DTQRGTFSNG HHVDDSSAKP LEVTKTLWSH  360
LPTRIKEEDS GSPETRPLYD LNESATEVLS EGGEGFAVTQ QAYSLKHEDI SEATNGVTPM  420
PPGHHVLISL PGKNQGSLAA AEARKRRKEL TRLKNLHGRQ CRMQVG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1443448RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.1961s0053.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303620.10.0uncharacterized protein LOC17898066
TrEMBLR0II410.0R0II41_9BRAS; Uncharacterized protein
STRINGCagra.1961s0053.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein