PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.19206s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 108aa    MW: 12082.8 Da    PI: 6.0823
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.19206s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26096.13.7e-305102199
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +Ca+Ck+l+ +C++ C+  p+fp+++  +f+ vh++FGa+nv+k+l++l  eere+a+++l+y Aear rdPv+G++g+ l++++ l+ 
  Cagra.19206s0001.1.p   5 RCAVCKILNVTCEPTCICKPHFPSNS-TRFQDVHQIFGAENVHKILNSLGAEEREIAANCLCYAAEARRRDPVSGVYGMKLHYESILND 92 
                           6**********************987.89************************************************************ PP

                DUF260  90 lkaelallke 99 
                           +++e++++ +
  Cagra.19206s0001.1.p  93 VEQEIKSALN 102
                           ***9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.2614104IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-28599IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MASNRCAVCK ILNVTCEPTC ICKPHFPSNS TRFQDVHQIF GAENVHKILN SLGAEEREIA  60
ANCLCYAAEA RRRDPVSGVY GMKLHYESIL NDVEQEIKSA LNELETNL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545911e-167AC254591.1 Capsella rubella clone CAP08-M12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282797.11e-72hypothetical protein CARUB_v10006407mg
SwissprotO496515e-42LBD32_ARATH; LOB domain-containing protein 32
TrEMBLR0GTP61e-72R0GTP6_9BRAS; Uncharacterized protein
STRINGscaffold_702084.13e-49(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45251455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22700.13e-43LOB domain-containing protein 32