PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1914s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 842aa    MW: 95864 Da    PI: 7.6835
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1914s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57396.52.6e-3073167397
               DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifels 92 
                          ++++ws++Dei +L G+++++++t++ + +d+dafy ++++s+ +++sk q++ K+++LKk+fk++++k+++g   sf++++d++ f ls
  Cagra.1914s0012.1.p  73 SKMIWSKKDEIFILSGILEYQSETETCYNQDWDAFYGYIRESMRSDFSKAQIMGKVKKLKKRFKDNEAKINDGLRLSFTNTEDKELFRLS 162
                          789*************************************************************************************** PP

               DUF573  93 kkiWg 97 
                          k iW 
  Cagra.1914s0012.1.p 163 KLIWV 167
                          ****5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.6E-2574166IPR007592Protein of unknown function DUF573
SuperFamilySSF534743.13E-16254369IPR029058Alpha/Beta hydrolase fold
Gene3DG3DSA:3.40.50.18201.8E-12255516IPR029058Alpha/Beta hydrolase fold
PfamPF126971.0E-7302511IPR000073Alpha/beta hydrolase fold-1
SuperFamilySSF534743.13E-16434513IPR029058Alpha/Beta hydrolase fold
CDDcd079871.79E-43566803No hitNo description
PfamPF039821.2E-8635717IPR007130Diacylglycerol acyltransferase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016747Molecular Functiontransferase activity, transferring acyl groups other than amino-acyl groups
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MKRFNQGSDS RDSSNSQRCF EIRHNSNRPM LLSPHTREHE LDEDISGREA MLRRRKLPKT  60
TATLFPPSSS ASSKMIWSKK DEIFILSGIL EYQSETETCY NQDWDAFYGY IRESMRSDFS  120
KAQIMGKVKK LKKRFKDNEA KINDGLRLSF TNTEDKELFR LSKLIWVEKE TECVYEEKNK  180
DKIKSTQRLT SVAYGNRELG IGGRLKAAKN PYSFTEVARP EERKSLTDFF VEAGDFVRPD  240
GGDGGPPRWF SPLECGARAP GSPLLLYLPG IDGTGLGLIR QHKRLGEMFD IWCLHFPVKD  300
RTPARDLVKL IEKTVRSEHY RFPNRPIYIV GESIGASLAL DVAASNPDID FVLILANPVT  360
RFNSIMLQPL LSLLEILPDG LPSLILENFG LNQGSPLTKM FETMLNETDA AQMARGLLGE  420
LFATSSNLPT LIRIFPKDTL LWKLQLLKSA SASANSQMDT LNAQILILLS GRDQWLMNKE  480
DIERLHALPR CEVREFENSG QFLFLEDGVD LVSIIKRAYY YRHGKSFDYI SDYIPPSPFE  540
FKEYEESQRL LTAVTSPVYL STLSNGAVVR SLAGIPSEGP VLYVGNHMLL GMELHATAAH  600
FLKERNILLR GLAHPLMFTK TTGSKLPDVQ LYDLFRIVGA VPVSGMNFYK LLRSNAHVAL  660
YPGGVREALH RKGEEYKLFW PEHSEFVRIA SKFGAKIIPF GVVGEDDVFE MVLDYNDQMK  720
IPFLKSFIEE ITQDSVNLRN DEEGELGKQD LHVPGIIPKI PGRFYVYFGK PIETKGRKKE  780
LSDKENAHEV YLQVKSEVEN CMTYLKMKRE IDPYRNILPR LLYYLSHGLS SQIPTFDLRD  840
H*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283240.10.0hypothetical protein CARUB_v10004272mg
SwissprotQ9LW260.0Y3684_ARATH; Acyltransferase-like protein At3g26840, chloroplastic
TrEMBLR0GYC20.0R0GYC2_9BRAS; Uncharacterized protein
STRINGAT5G41120.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36340.12e-23DNA-binding storekeeper protein-related transcriptional regulator