PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1777s0039.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 258aa    MW: 29991.3 Da    PI: 9.8528
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1777s0039.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF404.9e-13950243
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         +i +ks r  tf kR+ g  KK +ELS+LC+++ + +i+s+ 
  Cagra.1777s0039.1.p  9 FIVDKSVRRATFNKRKRGFQKKMSELSTLCGIKTCGVIYSPY 50
                         7899***********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.755148IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-10159IPR002100Transcription factor, MADS-box
CDDcd002662.66E-23180No hitNo description
SuperFamilySSF554552.09E-16278IPR002100Transcription factor, MADS-box
PfamPF003197.5E-13950IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MKRRTKYSFI VDKSVRRATF NKRKRGFQKK MSELSTLCGI KTCGVIYSPY NPEPEAWPSR  60
EGAERVISEF LEVPIEKRRM VTQEALLCER IAREQRQLQK LRTENRDFEM QNIMFGFLRR  120
EIDVPNLGEL NIPDLISFID KYINKLTCRA KQLRENGESS SSLPLSRPPV APNSVVIPVE  180
DNDHKNHNQQ NLIQRQNDFR QVPQKIHKFN MNMNVNLDLS LNLNSNSKRR MILDLNQIPN  240
AEEHEDIPSM EGSNPPT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.1777s0039.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302784.11e-164MADS-box transcription factor PHERES 2
TrEMBLR0GIG31e-163R0GIG3_9BRAS; Uncharacterized protein
STRINGCagra.1777s0039.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.11e-60AGAMOUS-like 38