PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1718s0015.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NF-YB
Protein Properties Length: 157aa    MW: 16866.8 Da    PI: 6.1171
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1718s0015.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB188.35.2e-5920115297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplk+yl+kyr
  Cagra.1718s0015.1.p  20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKIYLQKYR 109
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          e+egek
  Cagra.1718s0015.1.p 110 EVEGEK 115
                          ****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-5615126IPR009072Histone-fold
SuperFamilySSF471134.19E-4222126IPR009072Histone-fold
PfamPF008083.4E-282589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.4E-225371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.4E-227290No hitNo description
PRINTSPR006156.4E-2291109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MADSDNDSGG HKDGGNASTR EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF  60
ISFITGEASD KCQREKRKTI NGDDLLWAMT TLGFEDYVEP LKIYLQKYRE VEGEKTTTAG  120
RQGDKEGGGA GSGSGGAPMY GGGMVPMGHQ FSHHFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A2e-5014110197NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.1718s0015.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1178181e-166AK117818.1 Arabidopsis thaliana At4g14540 mRNA for putative CCAAT-binding transcription factor subunit A(CBF-A), complete cds, clone: RAFL18-01-N02.
GenBankAL1615391e-166AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankBT0036841e-166BT003684.1 Arabidopsis thaliana At4g14540 mRNA, complete cds.
GenBankCP0026871e-166CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ973361e-166Z97336.1 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285415.11e-114nuclear transcription factor Y subunit B-3
SwissprotO233101e-100NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLR0H4531e-113R0H453_9BRAS; Uncharacterized protein
STRINGCagra.1718s0015.1.p1e-113(Capsella grandiflora)
STRINGXP_006285415.11e-113(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-94nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Han X, et al.
    Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis.
    J. Exp. Bot., 2013. 64(14): p. 4589-601
    [PMID:24006421]
  2. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  3. Hossain MA, et al.
    Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 650
    [PMID:27242851]
  4. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]