PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1671s0410.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 189aa    MW: 20945.8 Da    PI: 4.9953
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1671s0410.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.11.5e-4332130199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCkvlrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da++s+vyeAear+rdPvyG++g i +lq+q+++l
  Cagra.1671s0410.1.p  32 PCAACKVLRRRCADKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRADAVRSMVYEAEARIRDPVYGCAGAIYHLQRQVSEL 121
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          +a+la+++ 
  Cagra.1671s0410.1.p 122 QAQLAKAQV 130
                          *****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.14331132IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4332129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MESNGDASAA TAPIISSSSS PPPPPPRVVL SPCAACKVLR RRCADKCVLA PYFPPTDPAK  60
FTIAHRVFGA SNIIKFLQEL PESQRADAVR SMVYEAEARI RDPVYGCAGA IYHLQRQVSE  120
LQAQLAKAQV EMVNVQLQRS NLLELIYSMD QVQKQEQDNM SFESNDLGFL EENSNTNSSM  180
LWWDPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738410.0AB473841.1 Arabidopsis thaliana ASL8 mRNA for ASYMMETRIC LEAVES2-like 8 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305673.11e-122hypothetical protein CARUB_v10010390mg
SwissprotQ9LQR01e-116LBD1_ARATH; LOB domain-containing protein 1
TrEMBLR0GS201e-122R0GS20_9BRAS; Uncharacterized protein
STRINGAT1G07900.11e-114(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-115LOB domain-containing protein 1