PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1671s0385.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Dof
Protein Properties Length: 343aa    MW: 36875.6 Da    PI: 9.7047
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1671s0385.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57e-3984142361
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          +  lkcprCds+ntkfCyynny+lsqPryfCk+CrryWtkGGalrnvPvGgg+rkn+k+
  Cagra.1671s0385.1.p  84 DGPLKCPRCDSSNTKFCYYNNYNLSQPRYFCKGCRRYWTKGGALRNVPVGGGCRKNNKK 142
                          56789***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2969132IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3286141IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.51687141IPR003851Zinc finger, Dof-type
PROSITE patternPS01361089125IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MAFSSNWSQP TNSNHQHQHH HHQHQLHENG SIVGGHGLLS HQLPLLQANP NPNHHHVAAS  60
AGLPARMGGS MAERARQAKI PPPDGPLKCP RCDSSNTKFC YYNNYNLSQP RYFCKGCRRY  120
WTKGGALRNV PVGGGCRKNN KKGKNGNSKS SSSSSKQSSG VNAPSPSSGQ LRTNHQFPFS  180
PTLYNLTHLG GIGLNLAATN GNNQAHQIGS SLMNDLGFLH VGNGRNTSGQ ITGNIHDNNN  240
NNENNLMTSV GSLSHFTLFD PTTGLYPFPN EGNIGNNVGI SCSSTSMVDS RAYQTPPVKM  300
EEQSNQLANL SRPASGLTSP GNQTNQYFWP SSDFSGPSNE LL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). Involved in the regulation of root development (PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Element of a regulatory network controlling indole glucosinolates (IGS) biosynthesis, probably by inducing the expression of accurate genes (e.g. CYP83B1). Promotes apical dominance (PubMed:16740150). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.1671s0385.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA) (PubMed:10758484). Induced transiently in response to the generalist herbivore S.littoralis. Triggered by methyl jasmonate (MeJA) and wounding (PubMed:16740150). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0627150.0AY062715.1 Arabidopsis thaliana Strong similarity to zinc finger protein OBP2 (At1g07640; F24B9.30) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF24B90.0AC007583.2 Arabidopsis thaliana chromosome 1 BAC F24B9 sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306063.10.0dof zinc finger protein DOF1.1 isoform X1
SwissprotQ8L9V60.0DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLR0GT340.0R0GT34_9BRAS; Uncharacterized protein
STRINGCagra.1671s0385.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.31e-170Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]