PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1671s0259.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 208aa    MW: 23520.3 Da    PI: 9.8492
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1671s0259.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.21.5e-3426117192
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g ++++ ++l+  
  Cagra.1671s0259.1.p  26 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRICEELKLY 115
                          7***********************************************************************************999987 PP

               DUF260  91 ka 92 
                          k+
  Cagra.1671s0259.1.p 116 KS 117
                          75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.26425125IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-3226116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MMQRNSNAIT TTNNNNISNN PSTHQACASC KHQRKKCNNE CILSPYFPAR KTKEFQAVHK  60
VFGVSNVQKM VRTVREEDRT KLSDSLTWEA LWRQKDPVLG SYGEYRRICE ELKLYKSLVH  120
NQPLLGWDNN QRVYSNNNNK TGLVMNSSGS GVFSGNNNGA GVNGEIVNGG YSSRNLQGGW  180
ENPKHDQRQQ CYAVINGFKQ QHYHLPL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankF9P140.0AC025290.3 Sequence of BAC F9P14 from Arabidopsis thaliana chromosome 1, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAB4738650.0AB473865.1 Arabidopsis thaliana ASL32 mRNA for ASYMMETRIC LEAVES2-like 32 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304620.11e-121hypothetical protein CARUB_v10011711mg
SwissprotQ9LNB91e-115LBD2_ARATH; LOB domain-containing protein 2
TrEMBLR0IKK61e-121R0IKK6_9BRAS; Uncharacterized protein
STRINGscaffold_100624.11e-116(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.15e-96LOB domain-containing protein 2