PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.16435s0018.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 180aa    MW: 20094 Da    PI: 10.2376
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.16435s0018.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.91.1e-0878123550
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                           k+ +r + NR++A++sR +K+ ++e L +k+ eLe e + L+ +le
  Cagra.16435s0018.1.p  78 KKLKRVIANRVSAQKSRWKKLLYVEALVKKSMELERETSVLRAQLE 123
                           899**************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.7E-971132No hitNo description
SMARTSM003382.7E-574145IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.20976139IPR004827Basic-leucine zipper domain
PfamPF077161.3E-776123IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-978132No hitNo description
CDDcd147031.48E-1379130No hitNo description
PROSITE patternPS0003608196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MSFPVAATSF RVPQSGGQGG VPQSGSQAEV SQSGSQSGGS QSGSSQEGEK KAPYVQYEVE  60
PGFTIRMRHN IDPAMDPKKL KRVIANRVSA QKSRWKKLLY VEALVKKSME LERETSVLRA  120
QLEIAIEEKR RLQIEQRQLK ETLAARFQDC IDEKGIIEFY KVEIERLKKK NMAPPTNPT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286756.11e-128hypothetical protein CARUB_v10003197mg
TrEMBLR0GRZ21e-128R0GRZ2_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__672__AT5G07160.11e-64(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144181821
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.12e-59bZIP family protein