PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1642s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 726aa    MW: 78826.3 Da    PI: 6.0403
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1642s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.62.7e-13228289162
                          XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  Cagra.1642s0060.1.p 228 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKISYFMAENATLRQQ 289
                          678899******************************************99999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-16228292IPR004827Basic-leucine zipper domain
PfamPF001703.1E-11229290IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3230290IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-17232290No hitNo description
SuperFamilySSF579594.82E-12232290No hitNo description
CDDcd147042.03E-21233284No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MAEPIMEQPP PPAPDPNSTH PPPPPSDFDS ISIPPFDDQF YHPGSDQTPI GELMSDLGFP  60
DGEFELTFDG MDDLYFPAEN ESFLIPVNTS SQEQFGDFTP DSEGSGISGD PKDVFKNITT  120
SGCSNRESPR DSDDRCSGAD PSLDLPTPLS SQGSGNCASD VSEATNESSP KSRNVVVDQK  180
VKVEEAATTT SITKRKKEIE EDLSGESRSS KYRRSGEEDI DASAVTGEED EKKKARLMRN  240
RESAQLSRQR KKHYVEELEE KVRNMHSTIT DLNGKISYFM AENATLRQQL GGNGMCPPHH  300
PPPPMGMYPP MAPMPYPWMP CPPYMVKQQG SQVPLIPIPR LKPQNPLGTS KAKKSESKKS  360
EAKTKKVASI SFLGLLFCLF LFGALAPIVN VNYGGISGAF YGNYRPNYIT DQIYSQHRDR  420
VLDTSRSGAG TGVSNSNGMD CGRDSDRGTR NNISATESSV PPGNGSEPLV ASLFVPRNDK  480
LVKIDGNLII NSILASEKAV ASRKASESNE RKADLVIPKD YSPALPLPDV GRTEEMAKHL  540
YRSKTEKQKA LSSGSADSLK DQFKTKAANG EMQQWFREGV AGPMFSSGMC TEVFQFDVSS  600
TSGAIIPASP ATNVSAEHSK NTTDTRKRKN RRILRGLPIP LPGSDFNLTK EHQRNSSSKE  660
IKPASSMVVS VLVDPREGGD GDIDGMIGGP KSLSRVFVVV LLDSAKYVTY SCVLPRSGAP  720
HLVTT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293762.10.0hypothetical protein CARUB_v10022722mg
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLR0HN450.0R0HN45_9BRAS; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein