PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1642s0027.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 369aa    MW: 40757.8 Da    PI: 6.6161
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1642s0027.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.11.2e-10150207562
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  Cagra.1642s0027.1.p 150 KRAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 207
                          9*****************************************9999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-17146210IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622148211IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.3E-9150205No hitNo description
SuperFamilySSF579591.97E-10150201No hitNo description
PfamPF001701.6E-9150208IPR004827Basic-leucine zipper domain
CDDcd147032.92E-22151200No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MEDPSNPKSN QSNLPQCPPL ASAPTSAPFR GPYHRRAHSE VQFRLPEDLD LSEPFGGFDE  60
LGSEDDLFCS YMDIEKLGSG SGSASDSAGP SAPRSDNVFS AENGGAEAGN SRPRHRHSLS  120
VDGSSSLESI EAKKAMAPDK LAELWVVDPK RAKRIIANRQ SAARSKERKA RYILELERKV  180
QTLQTEATTL SAQLSLFQRD TTGLSSENTE LKLRLQVMEQ QAKLRDALND QLKKEVERLK  240
FATGEVSHAD AYNLGMAHMQ YQQQPQQSFF QHHQQQTDAQ NLQQMTHQFH LFQPNNNQNP  300
NTSSRPNPPN AHQHMHHANS NGPAQSHSYS EAMHEDPLGR LQGLDISSCG RGSNFGRSDT  360
VSESSTTM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0967460.0AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0742690.0AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296036.10.0hypothetical protein CARUB_v10025182mg
SwissprotQ6S4P41e-96RF2B_ORYSJ; Transcription factor RF2b
TrEMBLR0HGY50.0R0HGY5_9BRAS; Uncharacterized protein
STRINGAT2G40620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.10.0bZIP family protein