PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1508s0061.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 174aa    MW: 18797.2 Da    PI: 7.7891
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1508s0061.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.23.8e-45141131100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca+dCv++pyfpa++p+kfanvh++FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l
  Cagra.1508s0061.1.p  14 PCAACKLLRRRCAQDCVFSPYFPADEPQKFANVHRVFGASNVNKMLQELPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVL 103
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+lal+++e
  Cagra.1508s0061.1.p 104 QAQLALAQAE 113
                          *****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.27513114IPR004883Lateral organ boundaries, LOB
PfamPF031959.0E-4514111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MKESSSRKQG AASPCAACKL LRRRCAQDCV FSPYFPADEP QKFANVHRVF GASNVNKMLQ  60
ELPIHQRGDA VSSMVYEANA RVRDPVYGCV GAISSLQQQI DVLQAQLALA QAEVVHLRVR  120
HSTSFQGHGL CPDSPSSSGS PSSKQVSPQD NKGMFSHMDI VDEASLGESM WSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0156650.0BT015665.1 Arabidopsis thaliana At1g31320 gene, complete cds.
GenBankBT0150670.0BT015067.1 Arabidopsis thaliana At1g31320 gene, complete cds.
GenBankAB4738390.0AB473839.1 Arabidopsis thaliana ASL6 mRNA for ASYMMETRIC LEAVES2-like 6 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305715.11e-126hypothetical protein CARUB_v10010462mg
SwissprotQ9SHE91e-104LBD4_ARATH; LOB domain-containing protein 4
TrEMBLR0INC41e-126R0INC4_9BRAS; Uncharacterized protein
STRINGBra014907.1-P1e-109(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.15e-94LOB domain-containing protein 4