PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1508s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 583aa    MW: 65179.4 Da    PI: 5.9762
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1508s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.51.3e-111150342
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                         i + ++r+ +f kR+ gi KK  E+ +LCd++++ +i s+
  Cagra.1508s0040.1.p 11 IPDPTRRKASFKKRKRGIQKKLDEITTLCDVKACAVISSP 50
                         66789*******************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.2E-12160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.147149IPR002100Transcription factor, MADS-box
CDDcd002668.30E-21379No hitNo description
SuperFamilySSF554552.09E-18794IPR002100Transcription factor, MADS-box
PfamPF003194.6E-111151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MSTRPKKLSL IPDPTRRKAS FKKRKRGIQK KLDEITTLCD VKACAVISSP FEKNPVVWPS  60
KEGIKEVVSE FQQVPEYKRY TYMVNLETYL QERIGKATES LRKLREENYE SQLKQIMLDC  120
LVGTMKVQSC NPMGYDNLIG YIDSYLKRIE VSMQLHAENG ESSSLPPPPA SVDGVVAHDG  180
VDPPAVHEHA GPSNELHGYF PYDNMNLNLS NHEVPVQHQV LTQNQNQQGS VQYNPLINFN  240
DETAHRFSGM SLHQNMSQDP YQGMYQQGSF MNLLAALPQQ MGYVGEHAHV PYQQQPTIDL  300
AATGHMPVIT TTMTNTSTPA VHAPEMNLQD PYHQLSQQEP FMNLLPALPQ EMGYVGEHGH  360
VPFTNVNYQQ QPTIDFAATG HMPSITTTMT NTSTPGVYAP GMNLHQNMSL QGPYHHQLYQ  420
QEPLMNLLPA LPPQMGYVGE HAPVPFTNGN YQQQPTIDLA ATAQMPSITT MTNISTPGVY  480
APAMNLHQNM SLDPYQQMYQ QEPFMNLPQQ MGYVGEQAHV PFMNDNNYNY QQQPAIDPAT  540
TGHMPSITTT TTTTTTTTTT NTSTPGVYAP DISNLFNDKM WI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11631RKASFKKRKRGIQKKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.1508s0040.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306141.20.0agamous-like MADS-box protein AGL86
TrEMBLR0I9H80.0R0I9H8_9BRAS; Uncharacterized protein (Fragment)
STRINGCagra.1508s0040.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31630.11e-58AGAMOUS-like 86