PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1443s0015.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 533aa    MW: 59778.7 Da    PI: 5.3332
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1443s0015.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.81.8e-48111361128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          l+pGfrFhPtdeelvv+yLk+k+++kkl++ e+i e+d+yk++P++Lp k  +k+++++w+fFs rd+k+  g+r++rat++gyWkatgk
  Cagra.1443s0015.1.p  11 LAPGFRFHPTDEELVVYYLKRKIRRKKLRV-EAIGETDVYKFDPEELPeKaLYKTRDRQWFFFSLRDRKH--GSRSSRATDRGYWKATGK 97 
                          579***************************.89**************95345667899**********86..89**************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d+ +++ +++ vg kktLvf++grap+ge+t+Wvmhey++
  Cagra.1443s0015.1.p  98 DRVIKC-DSRPVGEKKTLVFHRGRAPNGERTNWVMHEYTM 136
                          ******.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-547161IPR003441NAC domain
PROSITE profilePS5100552.79711161IPR003441NAC domain
PfamPF023653.5E-2613135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010224Biological Processresponse to UV-B
GO:0031930Biological Processmitochondria-nucleus signaling pathway
GO:1900409Biological Processpositive regulation of cellular response to oxidative stress
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MMDLTGENGG LAPGFRFHPT DEELVVYYLK RKIRRKKLRV EAIGETDVYK FDPEELPEKA  60
LYKTRDRQWF FFSLRDRKHG SRSSRATDRG YWKATGKDRV IKCDSRPVGE KKTLVFHRGR  120
APNGERTNWV MHEYTMHEEE LKRCGGGDVK DAYVLYKIYK KSGSGPKNGE QYGAPFIEEE  180
WVEEGDEVDE PVDVVHVPAN QVIVSNGVDS NLWSKGLNQS QLDDNDIEEL MRQVSDQPGP  240
TVQLNGVSGL DSHVESYNLV NLEKDMYLEI DDLLLPEPEP TSVEAMQKDW NQDSSGVLND  300
NDFVDADSYF CDLGARNLES DPVSGHFENG FEQSLPMNTS LVTDQANNNQ FPQHTRKNQA  360
SNWPLRNSYT RKMNSGSSLM QEPNNDRLTA ARFVEVPGTG DPSKFTNPLP SGTSITKEDE  420
AAKDESSQFA SSLWAFLESV PANPAYASEN PFVKLNLVRM SNSGGLFRFA SKSNAVVMAS  480
DSALNRKKSG RKNDKKNNKS KGFFCLSIIG ALCALFWVII GTMGVSGRSL LW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-431116720174NAC domain-containing protein 19
3swm_B1e-431116720174NAC domain-containing protein 19
3swm_C1e-431116720174NAC domain-containing protein 19
3swm_D1e-431116720174NAC domain-containing protein 19
3swp_A1e-431116720174NAC domain-containing protein 19
3swp_B1e-431116720174NAC domain-containing protein 19
3swp_C1e-431116720174NAC domain-containing protein 19
3swp_D1e-431116720174NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13138KIRRKKLR
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Involved in oxidative stress tolerance by mediating regulation of mitochondrial retrograde signaling during mitochondrial dysfunction. Interacts directly with the mitochondrial dysfunction DNA consensus motif 5'-CTTGNNNNNCA[AC]G-3', a cis-regulatory elements of several mitochondrial retrograde regulation-induced genes, and triggers increased oxidative stress tolerance. {ECO:0000269|PubMed:24045019}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00176DAPTransfer from AT1G32870Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.1443s0015.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat, salt stress, abscisic acid (ABA) and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307217.10.0NAC domain-containing protein 13
SwissprotF4IED20.0NAC13_ARATH; NAC domain-containing protein 13
TrEMBLR0IN970.0R0IN97_9BRAS; Uncharacterized protein
STRINGCagra.1443s0015.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM153171517
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32870.10.0NAC domain protein 13
Publications ? help Back to Top
  1. Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
    Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress.
    Plant Cell, 2014. 26(12): p. 4656-79
    [PMID:25549671]
  2. O'Shea C, et al.
    Structures and Short Linear Motif of Disordered Transcription Factor Regions Provide Clues to the Interactome of the Cellular Hub Protein Radical-induced Cell Death1.
    J. Biol. Chem., 2017. 292(2): p. 512-527
    [PMID:27881680]