PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1443s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 657aa    MW: 74376.6 Da    PI: 6.5159
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1443s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.13.4e-53131401128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          lp GfrF+Ptdeel+++yL+ k++g++ e+ +vi+e+d++k+ePwdLp  + +k++++ew+fF++rd+ky++g+r+nrat+ gyWkatgk
  Cagra.1443s0001.1.p  13 LPLGFRFRPTDEELINHYLRLKINGRDSEV-RVIPEIDVCKWEPWDLPglSVIKTDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGK 101
                          699************************999.99***************6448899999******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d++++s k+  +g+kktLvfy+grap+ge+t+W+mheyr+
  Cagra.1443s0001.1.p 102 DRTIKS-KKVIIGMKKTLVFYRGRAPRGERTNWIMHEYRA 140
                          ******.9999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-636163IPR003441NAC domain
PROSITE profilePS5100558.19813163IPR003441NAC domain
PfamPF023652.0E-2714139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MTTEQALLSM EALPLGFRFR PTDEELINHY LRLKINGRDS EVRVIPEIDV CKWEPWDLPG  60
LSVIKTDDQE WFFFCPRDRK YPSGHRSNRA TDIGYWKATG KDRTIKSKKV IIGMKKTLVF  120
YRGRAPRGER TNWIMHEYRA TDKELDGTGA GQNPFVLCRL FHKPSDSCDI ANCDGIENVN  180
TTPTTTRCSP DDTSSEMVQE TATSRVHALN RSDDTERCLS DKSNDVKPDV SVINNTTSTN  240
HAESSRAKDR GLGKTVVEEN PPARDNLTHY GSSFTQMNDR TYHPSHSSID FAASHIDSMY  300
SSDFGNFDYG LHFQDGAAEQ DASLTDVLDE VFHINNDSST ERKDFALPNM MHWPGNTRLL  360
STEYPFRKDA VSFVDGSAEV SGSQFVPENI APRWVSQHRV DSKEVTEIQS SSGSSRTVTP  420
LHSNVSGQYA SASYASIDPF NYNVNNPEQS SFEQSQTDRK ISPSDISEFK GRSRESQTNQ  480
DFVVDQGTAP RRIRLQIELP LTPVNHKKDD NYEEDEVQSA MSKVVEVNER SFLNRDDTLS  540
ESAKLKTQGT AQRRIRLQTR LRKPPVTLNN PRKHLNCSNE EASHREMQEK EDVSSSSSSS  600
SWQKEKKIVK KSLVQYSSMV IIMVVIVVLV GVWKESRDAK CSFLFHHLDS FKGMFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-46816712169NO APICAL MERISTEM PROTEIN
1ut4_B2e-46816712169NO APICAL MERISTEM PROTEIN
1ut7_A2e-46816712169NO APICAL MERISTEM PROTEIN
1ut7_B2e-46816712169NO APICAL MERISTEM PROTEIN
3swm_A2e-46816715172NAC domain-containing protein 19
3swm_B2e-46816715172NAC domain-containing protein 19
3swm_C2e-46816715172NAC domain-containing protein 19
3swm_D2e-46816715172NAC domain-containing protein 19
3swp_A2e-46816715172NAC domain-containing protein 19
3swp_B2e-46816715172NAC domain-containing protein 19
3swp_C2e-46816715172NAC domain-containing protein 19
3swp_D2e-46816715172NAC domain-containing protein 19
4dul_A2e-46816712169NAC domain-containing protein 19
4dul_B2e-46816712169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). {ECO:0000250|UniProtKB:Q949N0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.1443s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, heat and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306958.10.0NAC domain-containing protein 14 isoform X2
SwissprotB5X5700.0NAC14_ARATH; NAC domain-containing protein 14
TrEMBLR0GVM40.0R0GVM4_9BRAS; Uncharacterized protein
STRINGCagra.1443s0001.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55942848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.20.0NAC 014