PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1383s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 554aa    MW: 60751.1 Da    PI: 6.7317
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1383s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.81.3e-09409458554
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                          kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+ 
  Cagra.1383s0070.1.p 409 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLLQR 458
                          899***************************************99998864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-17405469IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.208407460IPR004827Basic-leucine zipper domain
PfamPF001701.3E-8409457IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.1E-11409459No hitNo description
SuperFamilySSF579594.26E-11409460No hitNo description
CDDcd147031.87E-24410459No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MGDTDKCNTD MIQRLPPSFG TSSSSSSSFP KNPIQQLDLN PNLMRSTPQF PQFSKPFSDT  60
GKRIGVPPSH PNLIPPTSPY SQIPTSRQPN YNPGGGHSRS MSQPNSFFSF DSLPPLSPSP  120
FRDSLSPQPD HDVSMDDPDS GAFTSNASLP PSPFTRCNST SSSSLRLPDS LPPRKSHRRS  180
NSDIPTGFSS IILHNSLPFR PLERSVSGGE SADWSKSSPF VKKESTCERE GVGEREAMDD  240
LFSAYMNLEN IDVLNSSEAD DSRNGNENRD DMDSSRASGT KTNGSDTEGE SSSVNETANN  300
NNTLISSGEK RESVKRRAAG GDIAPTSRHY RSVSVDSCFM EKLSFGDESL KPPPSPGTMS  360
RKVSPTNSVD GNSGAAFSIE FKNGEFTAAE MKKIMANDKL AEMAMSDPKR VKRILANRQS  420
AARSKERKMR YIVELEHKVQ TLQTEATTLS AQLTLLQRDM IGQTNQNNEL KFRLQAMEQQ  480
ARLRDALNEA LSGEVQRLKL AIGETSHNET DRSKMQSLNA EMFQQLNISQ SRQQSQQNQN  540
GTMALATKPE SND*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283456.10.0hypothetical protein CARUB_v10004500mg
TrEMBLR0GHR20.0R0GHR2_9BRAS; Uncharacterized protein
STRINGAT4G38900.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.30.0bZIP family protein