PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.13768s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 366aa    MW: 41258.8 Da    PI: 5.4977
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.13768s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.91.4e-37361361101
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e+++++am+s+++++ +r r Pv+G++gv ++lq  +  
  Cagra.13768s0012.1.p  36 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILERLDETQKPEAMKSIIFQSYVRDRSPVHGCLGVTQQLQYMIWL 124
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkeel 101
                           +++el++++++l
  Cagra.13768s0012.1.p 125 AEEELKAVNSQL 136
                           ******999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.97335136IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-3436133IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MSHVKHIHKG SLERFLDLLL IALFVLMTLK GGTSGACAAC KYQRRRCAAD CPLAPYFPAE  60
QPKLFQNVHR LFGVRSIVKI LERLDETQKP EAMKSIIFQS YVRDRSPVHG CLGVTQQLQY  120
MIWLAEEELK AVNSQLQLYR SQQQQHNGPT QTPHDHHNQM IHDLGLDNKH QEDVTSQLDL  180
GMGLNLNNNQ SNVVAPFFSP LPVSETQQPQ MSYTYSCSEV NNNVYSPPAY NTDSGKEILT  240
NNNNAWGVQN RYDMYNDNNG GGGFSNQNEN VHEMKSNNGV VGIQSQLVNL QMASNHRQQE  300
EEEDAHEYDE IHQFLQIIDD RQSFADSKEA YASSSGETLK EHNIDEIGEN ELRSAATCFS  360
LTSVN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292170.10.0hypothetical protein CARUB_v10018376mg
SwissprotQ9STS61e-167LBD27_ARATH; LOB domain-containing protein 27
TrEMBLR0HMD70.0R0HMD7_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_50012750.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-144LOB domain-containing protein 27