PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1365s0021.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 137aa    MW: 16191.2 Da    PI: 6.7193
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1365s0021.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.72.9e-093288460
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60
                          kr rr+  NRe+ArrsR   k+++e+L++ v++  a N+ L ++  +l +++ +  
  Cagra.1365s0021.1.p 32 EKRLRRMTCNRESARRSRMQGKMKMERLKTQVEQVMASNQFLSDKYVSLLELSHQIL 88
                         59**************************************99998877777766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-92881No hitNo description
SMARTSM003382.5E-42993IPR004827Basic-leucine zipper domain
PfamPF077161.1E-103080IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.5313180IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.31E-73382No hitNo description
CDDcd147027.21E-153485No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MYLQNPHDED FFHVHDHHVG NHDQPSVVTD QEKRLRRMTC NRESARRSRM QGKMKMERLK  60
TQVEQVMASN QFLSDKYVSL LELSHQILLE NSQLKKALSS FQEYYTTLCY GKRDDDHMLA  120
NINDFDLNLQ SLDQPY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006290053.11e-94hypothetical protein CARUB_v10003688mg
TrEMBLR0FLV41e-94R0FLV4_9BRAS; Uncharacterized protein
STRINGAT5G08141.13e-38(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17031811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08141.11e-35basic leucine-zipper 75