PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1365s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TCP
Protein Properties Length: 268aa    MW: 30293.6 Da    PI: 6.9717
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1365s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP91.91.3e-2848126382
                  TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssa 82 
                          g+kdrhsk+ T +g+RdRR+Rls+ +a++++dLq++LG+ ++sk i+WLl++ak  ++ l+ +++++ s+  +++ + s+
  Cagra.1365s0013.1.p  48 GGKDRHSKVFTVRGLRDRRIRLSVMTAIQVYDLQERLGLSQPSKVIDWLLEAAKNDVDLLPPLQFPPGSFH-QVNPNLSQ 126
                          78*************************************************************99999655.22222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.76849107IPR017887Transcription factor TCP subgroup
PfamPF036341.2E-2649156IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEMGLNSSIE DIRFKQEVAD DHNQPSSLSL MRQRWNNPRI VRVSKTFGGK DRHSKVFTVR  60
GLRDRRIRLS VMTAIQVYDL QERLGLSQPS KVIDWLLEAA KNDVDLLPPL QFPPGSFHQV  120
NPNLSQMGES FPGGVFDLGS CSNRDNMDLD NRKWARFDHN TSLDHGFDID HHHFSNSIQS  180
NKLYFPTSTT TSASSSYHYN IGHLQQSLLD QSGNVTVAFS TNSNLNPPFA ETMNSLFPRY  240
PSFLGGGHQL QLFNENSNSS NQRDHVE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00497DAPTransfer from AT5G08070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288467.10.0hypothetical protein CARUB_v10001730mg
SwissprotQ9LEZ91e-121TCP17_ARATH; Transcription factor TCP17
TrEMBLR0H8V50.0R0H8V5_9BRAS; Uncharacterized protein
STRINGAT5G08070.11e-119(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35762763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08070.11e-117TCP domain protein 17