PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1305s0026.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 455aa    MW: 50080.7 Da    PI: 9.0664
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1305s0026.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.33.9e-14374423554
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                          +r++r++kNRe+A rsR+RK+a++ eLe ++++L++ N++L+k+  e+ +
  Cagra.1305s0026.1.p 374 RRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEELQKKQVEIME 423
                          69*************************************99876555444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.4E-14370435IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.473372417IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-10374426No hitNo description
Gene3DG3DSA:1.20.5.1702.3E-13374430No hitNo description
PfamPF001707.6E-12374430IPR004827Basic-leucine zipper domain
CDDcd147071.33E-26374428No hitNo description
PROSITE patternPS000360377392IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MGSRTDFKNF VDGLTDEAAI HPKQPMMGTT LPLTRQNSVF SLTFDEFQNS WGGGIGKDFG  60
SMNMDELLKN IWTAEESHSM MGNNTSFNNI NNGNALINNN GGLSVGVGGE TGGGFLTGGS  120
LQRQGSLTLP RIISQKTVDD VWKELMKEDD VGNVVGNGGT SGIPQRQQTL GEMTLEEFLL  180
RAGVVREEPQ PVESVNNFNA GFYGFGSNAG LGTARNGIVA NQPHDFAGNG AVVRPDLLTT  240
QTQPLQMQQP LQMQQPQKVH QPQQLIQKQE RPFPKQTTIA FSNTVDAVNR SQLATQFQEV  300
KPSILGMQDH HMNNNLLQAV DFKTGVTVAA VSPGSQMSPD LTPKSALDAS LSPAPYMFGR  360
VRKTGAVLEK VIERRQKRMI KNRESAARSR ARKQAYTMEL EAEIAQLKEL NEELQKKQVE  420
IMEKQKNQLL EPLRQPWGMG CKRQCLRRTL TGPW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00038PBMTransfer from AT4G34000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0935460.0AF093546.1 Arabidopsis thaliana clone 11 abscisic acid responsive elements-binding factor (ABRE) mRNA, complete cds.
GenBankAY0814670.0AY081467.1 Arabidopsis thaliana unknown protein (F17I5.190:F17I5.200) mRNA, complete cds.
GenBankAY0546050.0AY054605.1 Arabidopsis thaliana Unknown protein (F17I5.190:F17I5.200) mRNA, complete cds.
GenBankAK1758510.0AK175851.1 Arabidopsis thaliana mRNA for abscisic acid responsive elements-binding factor (ABRE/ABF3), complete cds, clone: RAFL22-47-B14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284949.10.0hypothetical protein CARUB_v10006251mg
SwissprotQ9M7Q30.0AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLR0F7H30.0R0F7H3_9BRAS; Uncharacterized protein
STRINGAT4G34000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.20.0abscisic acid responsive elements-binding factor 3