PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1301s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 321aa    MW: 37121.6 Da    PI: 7.6823
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1301s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM47.36.6e-15111267128
                  NAM   7 FhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                          F+ +de +++++Lk+ v + +   e++i++vd+++ +P+     +  + ++  f + + ++++ gk      +sg Wk  g+dk ++s+ 
  Cagra.1301s0010.1.p  11 FNVEDEVIISRFLKRMVVNGDSMPEHFIQDVDVFNKNPNVE---F--DAERPRFVIVKPRTESCGKTDG--CESGCWKIIGRDKLIKSEk 93 
                          6678999*********88877555488***********643...2..2233445555556555554443..579*************986 PP

                  NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +g++ g kk+L f   r p+  k +Wvm+eyrl
  Cagra.1301s0010.1.p  94 TGKVLGFKKILKFCLSRGPREYKRSWVMEEYRL 126
                          78889**************************98 PP

2NAM31.93.9e-101803037128
                  NAM   7 FhPtdeelvveyLkkkvegkkleleevikevdiykvePwdL..pkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                          ++P  ee  v yL   ++++ ++  + +++ ++y+++P  L  p     e+  +  Fs++        r++ +  +gyWk   +d+++ s
  Cagra.1301s0010.1.p 180 YSPDTEEDDVPYLLTLAATEGNDWPSYVTNNNVYRLHPFALgdPFDQMFEDYGICIFSNET------CRTSDICYDGYWKIMHHDRPIRS 263
                          56666666668888888888888878899************43322223445566666543......377788899************** PP

                  NAM  95 kkgelvglkktLvfy......kgrapkgektdWvmheyrl 128
                          k+ge++g kk++ f+         +   +k +W+++eyrl
  Cagra.1301s0010.1.p 264 KSGETIGFKKVFRFHtvgelrYVCEGVEVKVTWTIDEYRL 303
                          ***************665543233444479********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100526.2945144IPR003441NAC domain
SuperFamilySSF1019415.1E-2611142IPR003441NAC domain
PfamPF023652.9E-911126IPR003441NAC domain
SuperFamilySSF1019418.89E-23164318IPR003441NAC domain
PROSITE profilePS5100519.488174318IPR003441NAC domain
PfamPF023651.6E-4223303IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MANELDNVGL FNVEDEVIIS RFLKRMVVNG DSMPEHFIQD VDVFNKNPNV EFDAERPRFV  60
IVKPRTESCG KTDGCESGCW KIIGRDKLIK SEKTGKVLGF KKILKFCLSR GPREYKRSWV  120
MEEYRLTKNL NKKQDHLICK IQFLFRAEII SLLAKHFSYL PTTKSVPVPA NLLLPAYGYY  180
SPDTEEDDVP YLLTLAATEG NDWPSYVTNN NVYRLHPFAL GDPFDQMFED YGICIFSNET  240
CRTSDICYDG YWKIMHHDRP IRSKSGETIG FKKVFRFHTV GELRYVCEGV EVKVTWTIDE  300
YRLNDAKHNK VLCVIKFTST *
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.1301s0010.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010473217.11e-160PREDICTED: uncharacterized protein LOC104752711
TrEMBLR0ETF20.0R0ETF2_9BRAS; Uncharacterized protein
STRINGCagra.1301s0010.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37041459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G60350.11e-152NAC domain containing protein 24