PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.12696s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 312aa    MW: 34612.7 Da    PI: 5.7492
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.12696s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.16.8e-17230286460
                           XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                            +r+rr++kNRe+A rsR+RK+a++ eLe+ +++Le+eN+ L ke+ee +ke ++  
  Cagra.12696s0002.1.p 230 AQRQRRMIKNRESAARSRERKQAYQVELETLAAKLEEENELLSKEIEEKRKERYQKL 286
                           79**********************************************999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.8E-14226282No hitNo description
SMARTSM003384.8E-12227291IPR004827Basic-leucine zipper domain
PfamPF001706.9E-16229287IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.289229281IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.44E-10231283No hitNo description
CDDcd147071.83E-18231277No hitNo description
PROSITE patternPS000360234249IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MTSFQVMRSS NSRNSDLSHR ISSSSSSSIR SHQQQFRRDL SNGCYGVRND GLLYSSTSMT  60
VEGILHDTFA SDPPAPTESS LLDASITLMD ASPAPMTVVE AGTETTTTTT TTTTTRDGKS  120
VDEVWREMVS GEGKGMKEET HEEIMTLEDF LAKAAVGDEA GAADDLDVKI SPTNYGFDHS  180
APPHNPFQMI DKVEGSIVAF GNGLDVFGGG GGARGKRARV MVEPLDKVAA QRQRRMIKNR  240
ESAARSRERK QAYQVELETL AAKLEEENEL LSKEIEEKRK ERYQKLMDFV IPVVEKPRQQ  300
RFLRRIRSLE W*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0864570.0AY086457.1 Arabidopsis thaliana clone 25211 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281546.10.0hypothetical protein CARUB_v10027647mg
SwissprotP427771e-69GBF4_ARATH; G-box-binding factor 4
TrEMBLR0GCP80.0R0GCP8_9BRAS; Uncharacterized protein
STRINGAT5G44080.11e-170(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-127bZIP family protein