PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.12686s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 342aa    MW: 39040.6 Da    PI: 7.4401
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.12686s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.11.6e-5391381129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPtdeel+++yLkkk++ +k+e+ evi+evd++k+ePwdL++++k     ++ewyfFs++d+ky+tg+r+nrat++g+Wkat
  Cagra.12686s0005.1.p   9 VPPGFRFHPTDEELLHYYLKKKISYHKFEM-EVIREVDLNKLEPWDLQERCKIgstPQNEWYFFSHKDRKYPTGSRTNRATHAGFWKAT 96 
                           69****************************.99**************964444222455****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           g+dk + + + +++g++ktLvfykgrap+g+ktdW+mheyrle
  Cagra.12686s0005.1.p  97 GRDKCIRN-SYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 138
                           *******9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-608160IPR003441NAC domain
PROSITE profilePS5100558.0189160IPR003441NAC domain
PfamPF023658.7E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGSSSNGGVP PGFRFHPTDE ELLHYYLKKK ISYHKFEMEV IREVDLNKLE PWDLQERCKI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATHA GFWKATGRDK CIRNSYKKIG MRKTLVFYKG  120
RAPHGQKTDW IMHEYRLEDA DDPQANPSED GWVVCRVFMK KNLFKVVNEG GSSINSSDQH  180
IHEASNNNHT LQARSFMHRD SPYQLVRNHG ATPFELNKPD LALHQYPPIF HKPPTLGFDY  240
SSGLARDCES AASEGLQYQQ ACEPGLEVGT CETVPSQNHQ QGLSEWGMMD RLVTCHMGNE  300
DSSRGIRFED GNNNASTVVQ PSPTTNQLTL RSEMDFWGYS K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-51916217167NO APICAL MERISTEM PROTEIN
1ut4_B2e-51916217167NO APICAL MERISTEM PROTEIN
1ut7_A2e-51916217167NO APICAL MERISTEM PROTEIN
1ut7_B2e-51916217167NO APICAL MERISTEM PROTEIN
3swm_A3e-51916220170NAC domain-containing protein 19
3swm_B3e-51916220170NAC domain-containing protein 19
3swm_C3e-51916220170NAC domain-containing protein 19
3swm_D3e-51916220170NAC domain-containing protein 19
3swp_A3e-51916220170NAC domain-containing protein 19
3swp_B3e-51916220170NAC domain-containing protein 19
3swp_C3e-51916220170NAC domain-containing protein 19
3swp_D3e-51916220170NAC domain-containing protein 19
4dul_A2e-51916217167NAC domain-containing protein 19
4dul_B2e-51916217167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.12686s0005.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1336810.0AY133681.1 Arabidopsis thaliana clone C103095 putative NAM/NAP (At4g10350) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006290194.10.0protein BEARSKIN2
SwissprotQ9SV870.0BRN2_ARATH; Protein BEARSKIN2
TrEMBLR0FKW80.0R0FKW8_9BRAS; Uncharacterized protein
STRINGCagra.12686s0005.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52132648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.10.0NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]