PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.12068s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 183aa    MW: 21228.3 Da    PI: 9.9081
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.12068s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF32.21.3e-10948342
                          --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                          +en+  r   f +  +g+lK  +EL +LCd+ +++iifs+
  Cagra.12068s0001.1.p  9 VENNKARAMIFKRKSEGLLKQVKELTILCDIWACLIIFSP 48
                          588888999999999************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.2E-8158IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.059147IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-5121IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-15392IPR002100Transcription factor, MADS-box
CDDcd002666.76E-20382No hitNo description
PfamPF003192.9E-10949IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-52136IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-53657IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MAKVKLAWVE NNKARAMIFK RKSEGLLKQV KELTILCDIW ACLIIFSPYE AEPVVWPCVK  60
TVRGLLKNFF AKPLLEQKKK QTCLKSYLKE KIKAIHKNLM KSQQKNKEYV TEQLMIQLHH  120
GRRISDLNLS EIYQLLAFSK DKITLGRLEL DFMEFAPLRD PPVLPFEVPD EQLMIITNDA  180
IV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.12068s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296244.11e-129agamous-like MADS-box protein AGL80
TrEMBLR0G1771e-127R0G177_9BRAS; Uncharacterized protein
STRINGCagra.12068s0001.1.p1e-131(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.11e-58AGAMOUS-like 48