PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1189s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family CPP
Protein Properties Length: 695aa    MW: 76615 Da    PI: 6.2201
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1189s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.93.2e-16398436240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Cagra.1189s0050.1.p 398 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 436
                          689**********************************96 PP

2TCR51.12.8e-16483521139
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                          ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Cagra.1189s0050.1.p 483 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 521
                          589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.2E-19397438IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.657398523IPR005172CRC domain
PfamPF036386.7E-12400435IPR005172CRC domain
SMARTSM011143.7E-17483524IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11485521IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 695 aa     Download sequence    Send to blast
MDKPQKNPTS QIGTSTPKSK FEDSPVFNYI SNLSPIESVK SISSAQTFSS LSFTSPPPVF  60
TSPHVNSHRE SRFFRCHNSI DRTKPLEALD GSVSKEVVVP VIEDLNKEAT LEDEEEETSV  120
EMSSELPQIL KSDSQTPDRS DSPCNEDVTM EAPSDIPRGD SGSCSEDFKM GLQKMLDVRE  180
GNDTPDCGRL ISDATELLVF RSPNDSEAFR CLVDKISSSE RRFCAGVKST KRPDITEDNP  240
ANGSRNENEP LALLPNEPVF NLHRGGMRRR CLDFEMPGKR KKDIADDQQS VCDNKAAGES  300
SSRCVVPGIG LHLNAVALSS RDTNINVIHD YSISGEIQKS FSDSTTPIHS QETMQEISDQ  360
AENEPVEEVP KAFVFPELNP GSLKKKKRVS EQAGEGDSCK RCNCKKSKCL KLYCECFAAG  420
VYCIEPCSCI DCFNKPIHED TVLATRKQIE SRNPLAFAPK VIRSADSIME AGDDASKTPA  480
SARHKRGCNC KKSNCLKKYC ECYQGGVGCS INCRCEGCKN AFGRKDGSLL VIMESKQEED  540
QETYEKRTAK IQHNIDVSKE VEQNASSDQP LTPLPPYRHL VVHQPFLSKN RLPPTQFFLG  600
TGSSSFRKPD SDLTQSHNEK RPCELVTEDK TETMPDILLN SPIANIKAIS PNSKRVSPPQ  660
LGSSESGSNL GRRGNGRKLI LRSIPAFPSL NPNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A9e-1740252014120Protein lin-54 homolog
5fd3_B9e-1740252014120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267281RRRCLDFEMPGKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.1189s0050.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2040590.0AF204059.1 Arabidopsis thaliana CXC domain protein TSO1 (TSO1) mRNA, complete cds.
GenBankAF2063240.0AF206324.1 Arabidopsis thaliana putative DNA binding protein (tso1) mRNA, tso1-3 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297098.10.0CRC domain-containing protein TSO1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLR0G3U80.0R0G3U8_9BRAS; Uncharacterized protein
STRINGCagra.1189s0050.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]