PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1150s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 419aa    MW: 47595.3 Da    PI: 6.5097
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1150s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.88.7e-53161431128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          l pGfrFhPtdeelv++yLk+kv++++l++ e i+++diyk++PwdLpk + ++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d+
  Cagra.1150s0013.1.p  16 LLPGFRFHPTDEELVSFYLKRKVQHNPLSI-ELIRQLDIYKYDPWDLPKFAMTGEKEWYFYCPRDRKYRNSSRPNRVTGAGFWKATGTDR 104
                          579***************************.89***************7777889*********************************** PP

                  NAM  91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++s+ +++ +glkk+Lvfykgra kg+ktdW+mhe+rl
  Cagra.1150s0013.1.p 105 PIYSSeGNKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 143
                          ****956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.29E-5912175IPR003441NAC domain
PROSITE profilePS5100557.53216175IPR003441NAC domain
PfamPF023651.2E-2518143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MGERTDDGEQ KMEEVLLPGF RFHPTDEELV SFYLKRKVQH NPLSIELIRQ LDIYKYDPWD  60
LPKFAMTGEK EWYFYCPRDR KYRNSSRPNR VTGAGFWKAT GTDRPIYSSE GNKCIGLKKS  120
LVFYKGRAAK GVKTDWMMHE FRLPSLSEPS PPSKRFFDSP VSPNDSWAIC RIFKKTSTTT  180
LRALSHSFVS SLPPETSTDT MSDQKPSNTY HFSSDKILKT SSPFQFHHEN MNTPKTSNST  240
TPSVATISPF SYLDFTSYDK PTSIFSPVSC LEQQYLTNLF LSTQETQPQF PRPTLSNEIP  300
SFLLNTSSNS TFLGMGEYTS HIDLSAVLAQ EECPALVSLP QEFQEKGFEG NGIMKNMRGS  360
NEDHHGHCDT LRYDVLASTP DENHQHHEDL KQNMTLLESY YSSLSSINGD LPACFSTT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-561617917169NO APICAL MERISTEM PROTEIN
1ut4_B2e-561617917169NO APICAL MERISTEM PROTEIN
1ut7_A2e-561617917169NO APICAL MERISTEM PROTEIN
1ut7_B2e-561617917169NO APICAL MERISTEM PROTEIN
3swm_A3e-561617920172NAC domain-containing protein 19
3swm_B3e-561617920172NAC domain-containing protein 19
3swm_C3e-561617920172NAC domain-containing protein 19
3swm_D3e-561617920172NAC domain-containing protein 19
3swp_A3e-561617920172NAC domain-containing protein 19
3swp_B3e-561617920172NAC domain-containing protein 19
3swp_C3e-561617920172NAC domain-containing protein 19
3swp_D3e-561617920172NAC domain-containing protein 19
4dul_A2e-561617917169NAC domain-containing protein 19
4dul_B2e-561617917169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.1150s0013.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0055080.0AC005508.1 Arabidopsis thaliana chromosome I BAC T2P11 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023632826.10.0protein FEZ
SwissprotQ9ZVH00.0FEZ_ARATH; Protein FEZ
TrEMBLR0GL880.0R0GL88_9BRAS; Uncharacterized protein
STRINGCagra.1150s0013.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.10.0NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]