PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1013s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 185aa    MW: 21042.1 Da    PI: 8.3195
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1013s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601247.5e-39121111100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++r+kC+kdCvlapyfp+++pk+f n hklFG+sn++k++k+++e++r++am+ l+++A+ara dPv G+++++ +l++++e+ 
  Cagra.1013s0013.1.p  12 ACAACKYQRKKCTKDCVLAPYFPQDRPKQFLNSHKLFGVSNITKMIKKVDESQRDIAMQNLIFHANARALDPVGGVYRIVCDLKRKIECC 101
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +ael+ + ++
  Cagra.1013s0013.1.p 102 QAELNFTLQQ 111
                          ****998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.06711112IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-3612107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MSLSSLSGGS TACAACKYQR KKCTKDCVLA PYFPQDRPKQ FLNSHKLFGV SNITKMIKKV  60
DESQRDIAMQ NLIFHANARA LDPVGGVYRI VCDLKRKIEC CQAELNFTLQ QIAMFRSLAQ  120
QEQRQRQDLP FGCHSYGGLL EQGDECINVD GYDYLQNMQQ EERRISDQEQ KHLLRQILMS  180
PSTN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301334.11e-136hypothetical protein CARUB_v10021744mg
SwissprotQ9SSM92e-81LBD7_ARATH; LOB domain-containing protein 7
TrEMBLR0GEJ31e-136R0GEJ3_9BRAS; Uncharacterized protein
STRINGAT1G72980.15e-79(Arabidopsis thaliana)
STRINGfgenesh2_kg.2__1557__AT1G72980.15e-79(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM154661417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.11e-82LOB domain-containing protein 7