PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0926s0015.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 120aa    MW: 14215.5 Da    PI: 7.4653
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0926s0015.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26079.84.3e-25697495
               DUF260  4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95
                          Ck  r +C ++Cv+apy+pa+++ k+  + k++ ++++ +++ +++++er++ ++s ++eAear+rdPv G++g i+ lq qle+ k  ++
  Cagra.0926s0015.1.p  6 TCKEVRHNCIEECVFAPYLPATNKDKYTKLSKVYDMRRLAQYVMDIEPSERQICVDSFCFEAEARLRDPVFGVTGYIHLLQLQLEEIKPLIQ 97
                         7***********************************************************************************99886555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.362103IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-23697IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MEYSCTCKEV RHNCIEECVF APYLPATNKD KYTKLSKVYD MRRLAQYVMD IEPSERQICV  60
DSFCFEAEAR LRDPVFGVTG YIHLLQLQLE EIKPLIQIAK RDHMMILQRN RQNHRHDHL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292169.13e-82hypothetical protein CARUB_v10018375mg
TrEMBLR0FR774e-82R0FR77_9BRAS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.22e-22LOB domain-containing protein 10