PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0926s0014.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 131aa    MW: 14946.4 Da    PI: 7.7551
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0926s0014.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26095.17.6e-3051014100
               DUF260   4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                           Ck  + +C ++Cv+apy+pa++p+k++ + k+F  s v +l+  ++++++++ ++sl++eAear+rdPv G++g+i++lq+ql++l+ +
  Cagra.0926s0014.1.p   5 ECKNVKHACIEECVFAPYLPANKPEKYNTLSKVFDISSVAELVMGIEPSQKQACVDSLCFEAEARLRDPVMGCTGLIRQLQHQLQNLQIQ 94 
                          59999************************************************************************************* PP

               DUF260  94 lallkee 100
                          l+ +k+e
  Cagra.0926s0014.1.p  95 LKIAKSE 101
                          **99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.9391102IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-29599IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MESCECKNVK HACIEECVFA PYLPANKPEK YNTLSKVFDI SSVAELVMGI EPSQKQACVD  60
SLCFEAEARL RDPVMGCTGL IRQLQHQLQN LQIQLKIAKS ELMMVLQEIH NRNRIAQQQN  120
LQHPYIRSRF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292306.12e-76hypothetical protein CARUB_v10018517mg
TrEMBLR0H7D02e-76R0H7D0_9BRAS; Uncharacterized protein
STRINGVIT_00s0340g00090.t012e-27(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-22LBD family protein