PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0917s0063.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 369aa    MW: 41979.6 Da    PI: 7.457
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0917s0063.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-1182118339
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                          ++k +rr+++NReAAr+sR+RKka++++Le+   +L 
  Cagra.0917s0063.1.p  82 PDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLI 118
                          6899**************************8655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-680143IPR004827Basic-leucine zipper domain
PfamPF001702.1E-882113IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.77282124IPR004827Basic-leucine zipper domain
CDDcd147088.54E-2384135No hitNo description
SuperFamilySSF579592.56E-784119No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-786112No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
PfamPF141444.3E-28170245IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MNSTSTHFVP PRRVGIYEPV HQFGMWGDSF KSNIGNGNMN TPTHIIIPNN QKLDNNLSED  60
TSHGTAGTPH MFDQEASTSR HPDKIQRRLA QNREAARKSR LRKKAYVQQL ETSRLKLIQL  120
EQELDRARQQ GFYVGNGIET NSLGFSETMN PGIAAFEMEY GHWVEEQNRQ ICELRTVLHG  180
HINDVELCLL VETAMKHYFE LFKMKSTAAK ADVFFVMSGM WKTSAERFFL WIGGFRPSDL  240
LKVLLPHFDI LTDQQILDVC NLRQSCQQAE DALTQGMEKL QHTLADCVAG GQLGEGSYIP  300
QVNSAMDRLE ALVSFVNQAD HLRHETLQQM YRILTTRQAA RGLLALGEYF QRLRALSSSW  360
ATRHREPT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00586DAPTransfer from AT5G65210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1288380.0AY128838.1 Arabidopsis thaliana DNA binding protein TGA1a-like protein (At5g65210) mRNA, complete cds.
GenBankAY0995930.0AY099593.1 Arabidopsis thaliana DNA binding protein TGA1a-like protein (At5g65210) mRNA, complete cds.
GenBankAY0870490.0AY087049.1 Arabidopsis thaliana clone 31032 mRNA, complete sequence.
GenBankAK3174880.0AK317488.1 Arabidopsis thaliana AT5G65210 mRNA, complete cds, clone: RAFL23-11-L19.
GenBankAK3171420.0AK317142.1 Arabidopsis thaliana AT5G65210 mRNA, complete cds, clone: RAFL21-72-M22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280664.10.0hypothetical protein CARUB_v10026623mg
SwissprotQ392370.0TGA1_ARATH; Transcription factor TGA1
TrEMBLR0EWJ40.0R0EWJ4_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0008_30700.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.50.0bZIP family protein