PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0834s0029.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 449aa    MW: 50642.6 Da    PI: 6.2481
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0834s0029.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1707.5e-53271541128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          l+pGfrFhPtdeelv++yLk+kv gk++++ ++i evdiyk+ePwdL   +++k++++ewyfFs  dkky +g r nrat++gyWkatgk
  Cagra.0834s0029.1.p  27 LAPGFRFHPTDEELVSYYLKRKVLGKPVRF-DAIGEVDIYKHEPWDLAvfSRLKTRDQEWYFFSALDKKYGNGARMNRATNKGYWKATGK 115
                          579************************999.99**************8544899999********************************* PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d+e+ + + +l g+kktLvf++grap+g +t+Wvmheyrl
  Cagra.0834s0029.1.p 116 DREIRR-DIQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 154
                          *****9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-6020179IPR003441NAC domain
PROSITE profilePS5100557.71227178IPR003441NAC domain
PfamPF023651.4E-2729154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MGRESVAVVS SPPSATAPST AVSATSLAPG FRFHPTDEEL VSYYLKRKVL GKPVRFDAIG  60
EVDIYKHEPW DLAVFSRLKT RDQEWYFFSA LDKKYGNGAR MNRATNKGYW KATGKDREIR  120
RDIQLLGMKK TLVFHSGRAP DGLRTNWVMH EYRLVEYETE NNGSLLQDAY VLCRVFHKNN  180
IGPPSGNRYA PFMEEEWADG GGALIPGVDV SVRVEPLPQA NGNKHMDQEI HSASKNLINI  240
NEPPRDGTPM DIEPNQQNHH ESDIKPQEHN NHNAYDEDEE TLKREHAEED ERPPPLCILN  300
KEAPLPLLQY KRRRQNESNS SSRNSQDHCS STITTVDNTT TLNSSSAAAT NTAISALLEF  360
SLMGISEKKE NQQLRPHKEA SPSTPLVSPE EKVNDLQKEI HQMSVERETF KLEMMSAEAM  420
ISILQSRIDA LRQENEELKK KNANGQAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-492218015170NAC domain-containing protein 19
3swm_B3e-492218015170NAC domain-containing protein 19
3swm_C3e-492218015170NAC domain-containing protein 19
3swm_D3e-492218015170NAC domain-containing protein 19
3swp_A3e-492218015170NAC domain-containing protein 19
3swp_B3e-492218015170NAC domain-containing protein 19
3swp_C3e-492218015170NAC domain-containing protein 19
3swp_D3e-492218015170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00342DAPTransfer from AT3G10480Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0834s0029.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0597950.0AY059795.1 Arabidopsis thaliana unknown protein (At3g10480) mRNA, complete cds.
GenBankAY0912620.0AY091262.1 Arabidopsis thaliana unknown protein (At3g10480) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023641098.10.0NAC domain containing protein 50 isoform X1
RefseqXP_023641099.10.0NAC domain containing protein 50 isoform X1
SwissprotQ9SQX90.0NAC50_ARATH; NAC domain containing protein 50
TrEMBLR0G4Z30.0R0G4Z3_9BRAS; Uncharacterized protein
STRINGCagra.0834s0029.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.10.0NAC domain containing protein 50
Publications ? help Back to Top
  1. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]