PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0834s0027.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 560aa    MW: 63200.6 Da    PI: 4.2297
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0834s0027.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.81.6e-5191361128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +++yk+ePwdLp k k+k+++ ewyfFs+ d+ky +g+++nrat+ gyWk+tgk
  Cagra.0834s0027.1.p   9 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVAHVYKSEPWDLPdKsKLKSRDLEWYFFSTLDSKYGNGSKTNRATEMGYWKTTGK 97 
                          579**************************9.99**************95347777888******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d+e+ + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  Cagra.0834s0027.1.p  98 DREIRN-GSKVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                          *****9.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-597159IPR003441NAC domain
PROSITE profilePS5100557.2989159IPR003441NAC domain
PfamPF023659.3E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MGGGSATSLA PGFRFHPTDE ELVRYYLKRK ICNKPFKFDA ISVAHVYKSE PWDLPDKSKL  60
KSRDLEWYFF STLDSKYGNG SKTNRATEMG YWKTTGKDRE IRNGSKVVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLVDEE LEITGVHQDA YVLCRIFQKS GSGPKNGEQY GAPFVEEEWE  180
EEEDDLSFEP DPDLGSEDHV YVHMDDTDQK PDNLVVYDAI PLPLNFNHEE SSNNAETNYS  240
DSINYIQPGN YVDSGGYFEK PEESSEKDQK PIICDGNLHN EALFQDDEIG SGVQNEQMAN  300
LQSSDNMFGT GSLCYNDFSV ESNYLTGDAF LDPNSNLLQN DGLYLETNDL SSTQQDGFHF  360
EDYLTFFDED DENAQNLTFD PSQLMGNEDA FVDQEELFQE IETEELKKEE TIGDKQVVEE  420
KEKDEASCSK QVDADATEFE PDYKYPFLKK ASNMLGAIPA PPAFASEFPT KDAVIRLNAG  480
QSSGSVHVTA GMITISDSNM GWAYDKNANR DLILSYHFVQ ENASGKLGNS LTRAMLIFMC  540
FWILLLSVSF KVSTLVASR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-44816516171NO APICAL MERISTEM PROTEIN
1ut4_B4e-44816516171NO APICAL MERISTEM PROTEIN
1ut7_A4e-44816516171NO APICAL MERISTEM PROTEIN
1ut7_B4e-44816516171NO APICAL MERISTEM PROTEIN
3swm_A4e-44816519174NAC domain-containing protein 19
3swm_B4e-44816519174NAC domain-containing protein 19
3swm_C4e-44816519174NAC domain-containing protein 19
3swm_D4e-44816519174NAC domain-containing protein 19
3swp_A4e-44816519174NAC domain-containing protein 19
3swp_B4e-44816519174NAC domain-containing protein 19
3swp_C4e-44816519174NAC domain-containing protein 19
3swp_D4e-44816519174NAC domain-containing protein 19
4dul_A4e-44816516171NAC domain-containing protein 19
4dul_B4e-44816516171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (Ref.6, PubMed:24323506, PubMed:25219309). Promotes reactive oxygen species (ROS) production during drought-induced leaf senescence. In response to abscisic acid (ABA)-mediated drought stress signals, binds directly to the promoters of RBOHC and RBOHE genes, encoding ROS biosynthetic enzymes, resulting in ROS accumulation and triggering leaf senescence via programmed cell death (PCD). ROS-induced leaf senescence sustains plant survival under drought conditions (PubMed:22313226). Involved in heat stress response. Modulates PCD through a ROS-mediated positive feedback control under heat stress conditions. This may provide an adaptation strategy for plant survival under extreme heat stress conditions (PubMed:25219309). Acts as repressor in preventing anther dehiscence during stamen development by suppressing genes that participate in jasmonic acid (JA) biosynthesis, such as DAD1, AOS, AOC3, OPR3 and 4CLL5/OPCL1 (PubMed:24323506). {ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:24323506, ECO:0000269|PubMed:25219309, ECO:0000269|Ref.6}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAPTransfer from AT3G10500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0834s0027.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) (PubMed:22313226, PubMed:25219309). Induced by heat shock (PubMed:25219309). Induced by cold, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:25219309}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0510030.0AY051003.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
GenBankAY0793450.0AY079345.1 Arabidopsis thaliana unknown protein (At3g10500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297351.10.0NAC domain-containing protein 53
SwissprotQ949N00.0NAC53_ARATH; NAC domain-containing protein 53
TrEMBLR0HKM10.0R0HKM1_9BRAS; Uncharacterized protein
STRINGCagra.0834s0027.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.10.0NAC domain containing protein 53
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
    Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress.
    Plant Cell, 2014. 26(12): p. 4656-79
    [PMID:25549671]
  4. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  5. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]