PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0802s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 245aa    MW: 28339.4 Da    PI: 9.8797
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0802s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57354.53.4e-1742125793
               DUF573   7 wseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelsk 93 
                          w+e+ +i++LqGl+df++ ++k+++dd+ + yef+k+ i f+  ++++veK+ +LK+K   +++k    +e s s+  dqk  +l  
  Cagra.0802s0008.1.p  42 WNEKAQISMLQGLMDFEDVKKKNAFDDMLETYEFLKDYIVFESYSQEFVEKMMSLKEKLMYHKRK---REERSSSERYDQKGSKLMT 125
                          ************************************************************99999...7788889999999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.5E-941123IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGKVNTNESK EKSKGTLLVN KDVNAKRSNK VGKKVCSETL KWNEKAQISM LQGLMDFEDV  60
KKKNAFDDML ETYEFLKDYI VFESYSQEFV EKMMSLKEKL MYHKRKREER SSSERYDQKG  120
SKLMTLVRED DVEHVVEKPK KSKGIAKPKE EKQEAVMIRE REKWFEDASL VREIVSRGGV  180
DEDTLKSKWD AVPVEKKSQM DQKWSVLRAK ENESLSQKSK FLKELVSIFR GASSSSSSSS  240
SLFM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299987.11e-157hypothetical protein CARUB_v10016201mg
TrEMBLR0I4G61e-157R0I4G6_9BRAS; Uncharacterized protein
STRINGscaffold_703767.11e-50(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16691712
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01370.16e-18DNA-binding storekeeper protein-related transcriptional regulator