PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0736s0041.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NF-YA
Protein Properties Length: 270aa    MW: 30132.7 Da    PI: 10.7361
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0736s0041.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.81.4e-31131187158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQyq+Il+RRq+Rakle+++kl ++ rkpylheSRh+hAl+R+RgsgGrF
  Cagra.0736s0041.1.p 131 NEPIFVNAKQYQAILRRRQHRAKLEAQNKL-IRVRKPYLHESRHRHALKRARGSGGRF 187
                          59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-35129190IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.378130190IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.4E-26132187IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.9E-23133155IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860135155IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.9E-23164187IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MMSTHFPRMK QTGFQLRDHD SSSTQSTGGE SYSEVASLSE PNNRYGHNIA THLSGYKVNP  60
ENTIGSHSNS ILSKVSQESV LLPIEAASWP ETPRINGFLS FPYASQHTMQ HPQIGGLVPS  120
RMPLPHNIPE NEPIFVNAKQ YQAILRRRQH RAKLEAQNKL IRVRKPYLHE SRHRHALKRA  180
RGSGGRFLNT KKLQESKSPH SPPFSGSPHV FKNSPGKFWQ QDISRGGVGS SGSTTSCSDI  240
TGNNNEMFQQ NPQFRFSGYP SNHHVSVLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-20131200268NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171180RHRHALKRAR
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0736s0041.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936130.0AB493613.1 Arabidopsis thaliana At3g14020 mRNA for hypothetical protein, partial cds, clone: RAAt3g14020.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298326.10.0nuclear transcription factor Y subunit A-6
RefseqXP_023641811.10.0nuclear transcription factor Y subunit A-6
RefseqXP_023641812.10.0nuclear transcription factor Y subunit A-6
SwissprotQ9LVJ71e-149NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLR0HNB90.0R0HNB9_9BRAS; Uncharacterized protein
STRINGCagra.0736s0041.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.11e-137nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]