PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0736s0021.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 335aa    MW: 37881.4 Da    PI: 6.6059
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0736s0021.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601292.1e-401022011100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++rrkCa+dC lapyfp++++++f nvhklFG+sn++k++k+l + e+++am++++++++ara+dPv G++g+i+klq q+e +
  Cagra.0736s0021.2.p 102 ACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNVHKLFGVSNITKIIKSLTPPEKDAAMHTIMFQSDARANDPVDGCYGIIRKLQYQIEYT 191
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++el+ + ++
  Cagra.0736s0021.2.p 192 RNELEIVLQQ 201
                          ****998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.699101202IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-37102198IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MKIVSHHKSK KPEEENNGNF LMMSDEEEKA GLKTACLSSL ISLHSPAFPS HQEKTKEPNS  60
PNLSNKKMPS GKPSSAFPLH PKPTPLKPSS STSNTNNNTN QACAACKYQR RKCAPDCLLA  120
PYFPHDRHRQ FLNVHKLFGV SNITKIIKSL TPPEKDAAMH TIMFQSDARA NDPVDGCYGI  180
IRKLQYQIEY TRNELEIVLQ QLAMFRDRAH HHHQEPQIQI QEPEDLSSFS GSCDLNNNSS  240
IPYNYPLNHV QEPSQQQQYC SSGNNFSGLQ EDMWCLQLQD SSTTVNMKAG FIDECEDIKP  300
VEEVSSERHE FEPHEAFLEQ RKLDLPSSQF IISS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373280.0AC237328.1 Arabidopsis lyrata clone JGIFAFI-41L7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298101.10.0hypothetical protein CARUB_v10014142mg
SwissprotQ9LRW11e-179LBD22_ARATH; LOB domain-containing protein 22
TrEMBLR0HMS10.0R0HMS1_9BRAS; Uncharacterized protein
STRINGAT3G13850.11e-177(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-159LOB domain-containing protein 22