PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0716s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NF-YB
Protein Properties Length: 115aa    MW: 12617.2 Da    PI: 4.923
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0716s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.71.1e-5520112193
                NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                          vreqdr+lPian+srimkk+lP n+ki+kdak+tvqecvsefisf+tseasdkcq+ekrkt+ngddllwa+atlGfedy+eplk+yl++y
  Cagra.0716s0005.1.p  20 VREQDRYLPIANISRIMKKALPPNGKIGKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGDDLLWAMATLGFEDYLEPLKIYLARY 109
                          69**************************************************************************************** PP

                NF-YB  91 rel 93 
                          re+
  Cagra.0716s0005.1.p 110 REV 112
                          *98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-5117111IPR009072Histone-fold
SuperFamilySSF471135.28E-3923112IPR009072Histone-fold
PfamPF008088.2E-282690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.1E-215472No hitNo description
PROSITE patternPS0068505773IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.1E-217391No hitNo description
PRINTSPR006153.1E-2192110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MADNTPSSPA GDGGESGGSV REQDRYLPIA NISRIMKKAL PPNGKIGKDA KDTVQECVSE  60
FISFITSEAS DKCQKEKRKT VNGDDLLWAM ATLGFEDYLE PLKIYLARYR EVWG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-4819111193NF-YB
4awl_B3e-4819111294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4819111294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00300DAPTransfer from AT2G38880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0716s0005.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0885541e-150AY088554.1 Arabidopsis thaliana clone 7805 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023639588.11e-77nuclear transcription factor Y subunit B-1
SwissprotQ9SLG03e-76NFYB1_ARATH; Nuclear transcription factor Y subunit B-1
TrEMBLR0HEP04e-77R0HEP0_9BRAS; Uncharacterized protein
STRINGCagra.0716s0005.1.p4e-80(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14802794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.62e-80nuclear factor Y, subunit B1