PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0612s0059.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NF-YB
Protein Properties Length: 176aa    MW: 19140.3 Da    PI: 5.3587
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0612s0059.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB183.51.7e-5726123198
                NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                          vreqdrflPian+srimk+ lP n+ki+kdaket+qecvsefisfvtseasdkcqrekrktingddllwa+atlGfe+y+eplkvyl++y
  Cagra.0612s0059.1.p  26 VREQDRFLPIANISRIMKRGLPLNGKIAKDAKETMQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKVYLMRY 115
                          69**************************************************************************************** PP

                NF-YB  91 relegekk 98 
                          re+eg++k
  Cagra.0612s0059.1.p 116 REMEGDTK 123
                          *****975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-5424141IPR009072Histone-fold
SuperFamilySSF471132.48E-4029134IPR009072Histone-fold
PfamPF008082.5E-273296IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.8E-216078No hitNo description
PROSITE patternPS0068506379IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.8E-217997No hitNo description
PRINTSPR006152.8E-2198116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MAESQTGGGG GSHESGGDQS PRSLNVREQD RFLPIANISR IMKRGLPLNG KIAKDAKETM  60
QECVSEFISF VTSEASDKCQ REKRKTINGD DLLWAMATLG FEEYIEPLKV YLMRYREMEG  120
DTKGSGKGGE SSGKRDGQPS QVSQFSQLPQ QGSFSQGPYG NSQASNMMVQ MPGTE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B7e-4726117192Transcription factor HapC (Eurofung)
4g92_B7e-4726117192Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0612s0059.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1768270.0AK176827.1 Arabidopsis thaliana mRNA for transcription factor NF-Y, CCAAT-binding - like protein, complete cds, clone: RAFL25-38-H16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023638284.11e-127nuclear transcription factor Y subunit B-10
RefseqXP_023638285.11e-127nuclear transcription factor Y subunit B-10
SwissprotQ67XJ21e-113NFYBA_ARATH; Nuclear transcription factor Y subunit B-10
TrEMBLA0A178VNV11e-111A0A178VNV1_ARATH; NF-YB10
TrEMBLD7LUH21e-111D7LUH2_ARALL; Uncharacterized protein
STRINGCagra.0612s0059.1.p1e-126(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14802794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.11e-100nuclear factor Y, subunit B10
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]