PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0568s0056.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 391aa    MW: 43052.1 Da    PI: 5.0782
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0568s0056.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573130.75.8e-41160255297
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          +fqr+w+e+Dei++L+Gl+d+k++tg+sp+dd++++y+ vkks+sf+vsk q++eK+r+LKkK++++v kak+g+epsf+k+hd+k+fel
  Cagra.0568s0056.1.p 160 YFQRVWTEDDEIAVLKGLMDYKNDTGVSPYDDTNGVYQLVKKSVSFDVSKIQFMEKLRSLKKKYENNVGKAKNGEEPSFAKAHDRKTFEL 249
                          79**************************************************************************************** PP

               DUF573  92 skkiWg 97 
                          sk  Wg
  Cagra.0568s0056.1.p 250 SKLAWG 255
                          *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.4E-32161255IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MSRKRFNPLE DPPTASSSDE DDELDAPIED GEEIVGNSSS DEEDDDVPSK NSAPPKNTVL  60
LLAAPARKLS EDSESGSEEE TESDSEPQKK DQLLTKPVIE TKNSVVKEIK KVKASEKSVG  120
KRSREMDEGG VSTHVKRVKK VSGEDDKKSG GGGEETKKTY FQRVWTEDDE IAVLKGLMDY  180
KNDTGVSPYD DTNGVYQLVK KSVSFDVSKI QFMEKLRSLK KKYENNVGKA KNGEEPSFAK  240
AHDRKTFELS KLAWGADGMA LDSAVKSNGK SKKSGKSKKV ASVKQELDSS LPNGKSFEDE  300
VANKEEVSLL GVLETDVFAK SSSLVKLLSR VGLDELAAHQ GLSMLASEDK KRLEEQWKAL  360
QVTEFEFFLQ KSGVIHEVMK KITEAFRSNI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303221.10.0hypothetical protein CARUB_v10011873mg
TrEMBLR0I1M20.0R0I1M2_9BRAS; Uncharacterized protein
STRINGAT1G11510.11e-123(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.19e-88DNA-binding storekeeper protein-related transcriptional regulator