PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0567s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 277aa    MW: 30033.7 Da    PI: 8.3766
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0567s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.33e-3954152199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++l
  Cagra.0567s0001.1.p  54 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHHIQSL 143
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          ++el ++++
  Cagra.0567s0001.1.p 144 QTELTTVRT 152
                          ****99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.04853154IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-4054151IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MNGNNNREGF GEYYEIVKKI KKDPTFETTT DHAVMGIRRH VAVPPGTTLN TVTPCAACKL  60
LRRRCAEECP FSPYFSPHEP HKFAAVHKVF GASNVSKMLL EVGESQRGDA ANSLVYEANL  120
RLRDPIYGCM GAISALQHHI QSLQTELTTV RTDILRYKYR EATTITSLQN NNSFNNTTTT  180
SSLSCDHHHG LASAILLPPP PPPPPPPRPP RLLSSHSHQP APPPTPPASL PSPSMVLSSS  240
SSSNSSATNS MYNPPPSSAA GYSNSMSSDN NVHYFD*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295750.11e-150hypothetical protein CARUB_v10024870mg
SwissprotQ9AT611e-135LBD13_ARATH; LOB domain-containing protein 13
TrEMBLR0HX361e-150R0HX36_9BRAS; Uncharacterized protein
STRINGAT2G30340.11e-133(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-113LOB domain-containing protein 13