PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0380s0033.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 474aa    MW: 52116.1 Da    PI: 6.1697
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0380s0033.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.21.1e-25179235259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +DgynWrKYGqK+vk+ + +rsYYrCt+++C +kk +e+s++ +kvvei+++g H he
  Cagra.0380s0033.1.p 179 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSECFAKK-IECSNDSGKVVEIVNKGLHSHE 235
                          7********************************98.*********************8 PP

2WRKY97.49.3e-31342399259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++++v+itY+g Hnh+
  Cagra.0380s0033.1.p 342 GDGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVENKTAVIITYKGVHNHD 399
                          5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.5E-20175237IPR003657WRKY domain
SuperFamilySSF1182908.5E-20175237IPR003657WRKY domain
SMARTSM007747.5E-24178236IPR003657WRKY domain
PROSITE profilePS5081116.972180237IPR003657WRKY domain
PfamPF031065.5E-17180234IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.4E-32326401IPR003657WRKY domain
PROSITE profilePS5081131.984336401IPR003657WRKY domain
SuperFamilySSF1182905.1E-27337401IPR003657WRKY domain
SMARTSM007741.9E-34341400IPR003657WRKY domain
PfamPF031068.3E-24343399IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MEDSVIDEAE VYAVEKSTPE TEKSEKLEPE KELHNGLSQL RDDESLGTIG EDMEDLHDEA  60
VRETLDKDQV EGVRENSSVE PNGEDLGVVK ETDCAKETVV STTMPVEEVE ENLEVETSPC  120
LTASSDSITV KPSLSSDPTT ASAAQGLSLV SVPAKQEQRS DSRVVNRLSV SPVPRTPARD  180
GYNWRKYGQK QVKSPKGSRS YYRCTYSECF AKKIECSNDS GKVVEIVNKG LHSHEPPRKN  240
SFSSREIRAA SAIRPVSKDN TVVEELTIVP SGSDPAASAK ENICDSQPFI EQKRHCENEA  300
VDEPEPKRRL KKENSQSSDT VSKPGKKNKF VVHAAGDVGI CGDGYRWRKY GQKMVKGNPH  360
PRNYYRCTSA GCPVRKHIET AVENKTAVII TYKGVHNHDM PVPKKRHGPP SSMLVAAAAP  420
TSMRTRTDDQ VNIPTSSQRK SEKQSNEAVD VGGEKVMESA RTLLSIGFEI KQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25332401877Probable WRKY transcription factor 4
2lex_A2e-25332401877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0051100.0BT005110.1 Arabidopsis thaliana clone U20909 putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
GenBankBT0040860.0BT004086.1 Arabidopsis thaliana clone RAFL15-37-C10 (R20909) putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285471.10.0hypothetical protein CARUB_v10006890mg, partial
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLR0GNC40.0R0GNC4_9BRAS; Uncharacterized protein (Fragment)
STRINGAT4G30935.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32