PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0352s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family FAR1
Protein Properties Length: 811aa    MW: 93044.5 Da    PI: 6.8304
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0352s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR176.94.1e-2457142291
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                          fY+eYA++vGF +++++s++skr+g++++ +  Cs+ g+++e++ +     ++r+  +tgCka l++k+++d+kw+++++++eHnHe++p
  Cagra.0352s0013.1.p  57 FYREYARSVGFGITIKASRRSKRSGKFIDVKIACSRFGTKREKSAA----INPRSCPKTGCKAGLHMKRKEDEKWVIYNFVKEHNHEICP 142
                          9***************************************998877....99***********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.1E-2157142IPR004330FAR1 DNA binding domain
PfamPF105513.8E-22224316IPR018289MULE transposase domain
PROSITE profilePS5096610.299502540IPR007527Zinc finger, SWIM-type
PfamPF044343.2E-6512537IPR007527Zinc finger, SWIM-type
SMARTSM005754.1E-7515542IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 811 aa     Download sequence    Send to blast
MDVEDVEIDL LTTSGNVDEF CEASTSGNVA PSLEQYANVG EPGNGMEFES KEAVYYFYRE  60
YARSVGFGIT IKASRRSKRS GKFIDVKIAC SRFGTKREKS AAINPRSCPK TGCKAGLHMK  120
RKEDEKWVIY NFVKEHNHEI CPDDFYISIR GKNKPAVSLA NQKKGLQLAL EKEDLKLLLD  180
HFMDMQDKQP GFFYAVDFNS ENHVRNVFWL DAKAKHDYRS FSDVVLFDTF YVRSRYRIPF  240
APFIGVSHHC QYVLLGCVLI GEESESTYSW LFRTWLKAVG GQAPGVMITD QDKLLSDIVV  300
EVLPTARHFF CLWNVLSKIP EMLNPFLSED DGFMESFWNC VNSSWIDEQF ERRWSNVISK  360
FELNENEWVQ LLFRDRKKWV PLYFHGICLA GLSGPERPGS IASHFDNYMN AEATFKDFFE  420
LYKQFLQYRC DVEAKVDLES QSKQPTLRST LAFEKQLSLI YTDAAFKKFQ AEVLGVVSCQ  480
PRKEREDGTT VIFRVEDFEE RQNLSVVLNK ELLNVYCSCH LFEYHGFLCK HAILVLQNSD  540
VSCIPSQYIL KRWSKRCNNI EGKKEKCVYI HNRMARFDDL CRRFVKLGEV ASLSDEAYKT  600
ALKLLEETKK HCVNNSPKFP SEPDKLMTGV CVSIGLESEG MLESTSKLSK KKKIQKKRKV  660
YCRPEDATNR SEELQQETEQ VSPRAPAFEN CYIPQADMEE TEQRSSATNL GVYYSSHQTI  720
QGFSSVTSIQ DGYYGHPPTI KAMGSMYSFH GRMSQYETQS SIQGAFQGQT SFRGSAIRGC  780
YDIEETLHDD MTMESSQFQG SGPSNRRFSN *
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0352s0013.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293361.10.0protein FAR1-RELATED SEQUENCE 2 isoform X1
SwissprotQ3EBQ30.0FRS2_ARATH; Protein FAR1-RELATED SEQUENCE 2
TrEMBLR0HA260.0R0HA26_9BRAS; Uncharacterized protein
STRINGCagra.0352s0013.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32250.30.0FAR1-related sequence 2
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]