PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0338s0014.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 393aa    MW: 43428.8 Da    PI: 6.0216
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0338s0014.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573124.74.2e-39144236298
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          +fqrlwseeDei+lLqG+idfka++g+sp+dd+++f++  kk+isf+vsk+q+++Kir+LK+K+++k +k     +++fsk+hd+k++ l
  Cagra.0338s0014.1.p 144 RFQRLWSEEDEISLLQGMIDFKAEKGTSPYDDMNGFFDEYKKCISFNVSKTQFSDKIRSLKNKYRGKDNK----GDKTFSKSHDEKCLRL 229
                          79*******************************************************************9....7789************ PP

               DUF573  92 skkiWgs 98 
                          ++ iWgs
  Cagra.0338s0014.1.p 230 ANCIWGS 236
                          *****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-30145235IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010629Biological Processnegative regulation of gene expression
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005730Cellular Componentnucleolus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MPKKLLNPLE DPPTASSSEE EEVEHSSSED EEQISNPSSE EDEPKDPATE TLKTPSPAKP  60
AVSLSSGSET GSDSESEPAE KTVAVTAAKS KKKKSDVSTP VKSGKKRGSE ATTSTNTKEH  120
AKRAKKVSGD EEKKNVVQVD KKPRFQRLWS EEDEISLLQG MIDFKAEKGT SPYDDMNGFF  180
DEYKKCISFN VSKTQFSDKI RSLKNKYRGK DNKGDKTFSK SHDEKCLRLA NCIWGSDSLA  240
LNSAVKSPVK SKKVDTKKKK KKLESEVEDE DKEVLGSDAM ALESVAVKAN GNGKKVESLK  300
PEGEKVEEDN EVMILDGDSE SSNLFENSFL IRSIVSLGLD EYSVKQKWSK MPIETKKRIE  360
EKLKMVKAME YKLVVQKADV VKQVASVINE AV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297863.10.0hypothetical protein CARUB_v10013903mg
TrEMBLR0G5T30.0R0G5T3_9BRAS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00238.17e-62DNA-binding storekeeper protein-related transcriptional regulator