PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0338s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family CPP
Protein Properties Length: 572aa    MW: 61659.4 Da    PI: 8.7985
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0338s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-14103143142
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                          ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  Cagra.0338s0002.1.p 103 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVEN 143
                          589**************************.********9875 PP

2TCR50.25.2e-16189227240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          + kgC+Ckks ClkkYCeCf+a+ +Cse+CkC dCkN e
  Cagra.0338s0002.1.p 189 HYKGCHCKKSGCLKKYCECFQANIFCSENCKCLDCKNFE 227
                          789**********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-16103143IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.157104228IPR005172CRC domain
PfamPF036387.1E-11105140IPR005172CRC domain
SMARTSM011142.7E-19188229IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.7E-13191226IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MGEGEGEGDK LPPEKEEITQ DSKKSARQLD FTDVALPQSN QAPVASMPVT ATRPVTSQAR  60
PVIPIPPPPQ PQGFLHVPIR HPKPESPKSK PRPVGETRDG TPQKKKQCNC KHSRCLKLYC  120
ECFASGTYCD GCNCVNCFNN VENEPARREA VNSTLERNPN AFKPKIASSP HGRRDNWEVV  180
GEVVTSGKHY KGCHCKKSGC LKKYCECFQA NIFCSENCKC LDCKNFEGSE ERQSLFHSDH  240
SHNVAYLQHV NAAITGAIGS SGFASAPAPK RRKGQEISFN QGTKDSSTHR LGQANNGRTT  300
PSTTGSRTGG NTSLGPSKVV YRSLLADIIQ PKNVQALCST LVAVAGEVAK AFTKKRLADQ  360
KETSMSSSVQ DQGQGNNKGT EVEKAVSANQ AEKSGLEDTN FGSKGRSLSP ETLSLMCDER  420
DTMLMVAASP NCSVKPTSQL PNGQDQVYAD QEKVVLIKFR DYLNRIISQG GIKESNCSLS  480
RTNLDTTPVH TAVKIQPVVQ QGPVANGFSQ TIKQPSHLTT TTPTPTPTPT PTPTPAPTPT  540
PTPAPKPTPT PTTSSQTHLQ KTPSLFETKD L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-35952371132Protein lin-54 homolog
5fd3_B5e-35952371132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0338s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935560.0AB493556.1 Arabidopsis thaliana At2g20110 mRNA for hypothetical protein, partial cds, clone: RAAt2g20110.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297342.10.0protein tesmin/TSO1-like CXC 6
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLR0HXL30.0R0HXL3_9BRAS; Uncharacterized protein
STRINGCagra.0338s0002.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein