PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0248s0059.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 271aa    MW: 30934.1 Da    PI: 7.0988
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0248s0059.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.6e-5171311128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lp+GfrFhPtdeelv++yL+++++++++++  vi+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk
  Cagra.0248s0059.1.p   7 LPAGFRFHPTDEELVKFYLCRRCASEPISV-PVIAEIDLYKFNPWELPEMALYGEKEWYFFSHRDRKYPNGSRPNRAAGTGYWKATGADK 95 
                          799***************************.89***************7666789*********************************** PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++ +   ++ g+kk Lvfy g+apkg kt+W+mheyrl
  Cagra.0248s0059.1.p  96 PIGK--PKTLGIKKALVFYAGKAPKGIKTNWIMHEYRL 131
                          **98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-603160IPR003441NAC domain
PROSITE profilePS5100558.7747160IPR003441NAC domain
PfamPF023653.2E-268131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MRAELNLPAG FRFHPTDEEL VKFYLCRRCA SEPISVPVIA EIDLYKFNPW ELPEMALYGE  60
KEWYFFSHRD RKYPNGSRPN RAAGTGYWKA TGADKPIGKP KTLGIKKALV FYAGKAPKGI  120
KTNWIMHEYR LANVDRSASS TNKKNNLRLD DWVLCRIYNK KGTMEKYLPA DEKPTPMMTT  180
SDSRCSSHVI SPDVTCSDHW EVQSEPKWLD LEDALEAFDD KSMFGGGSIE LLQNDAFVPQ  240
FPYHSDFATP FQDAPEQKPF LNWMSFAPQG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-80316611174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in regulation of seed germination under flooding. {ECO:0000269|PubMed:19176720}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0248s0059.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By low-oxygen stress. {ECO:0000269|PubMed:19176720}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0884310.0AY088431.1 Arabidopsis thaliana clone 6637 mRNA, complete sequence.
GenBankBT0008960.0BT000896.1 Arabidopsis thaliana clone C104908 unknown protein (At5g63790) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280952.10.0NAC domain-containing protein 102
SwissprotQ8H1151e-175NA102_ARATH; NAC domain-containing protein 102
TrEMBLR0GNC10.0R0GNC1_9BRAS; Uncharacterized protein
STRINGCagra.0248s0059.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63790.11e-168NAC domain containing protein 102
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  4. Li B, et al.
    Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis.
    Plant Cell, 2018. 30(1): p. 178-195
    [PMID:29317470]