PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0228s0023.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 383aa    MW: 43478 Da    PI: 4.153
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0228s0023.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573100.81.2e-3152144597
               DUF573   5 rlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskk 94 
                            w+++De+v+L G++df+++t+ s+ +d da+y+++k+ +++++sk+ql++K+r+LK+Kf ++++++++gke sf+ ++d+ if+ls++
  Cagra.0228s0023.1.p  52 IKWTKNDELVILGGIVDFENETKLSYRSDRDALYHYIKDYVESNFSKRQLIDKVRSLKRKFIDNQARSNDGKELSFTDTDDDAIFKLSMM 141
                          45**************************************************************************************** PP

               DUF573  95 iWg 97 
                          iW 
  Cagra.0228s0023.1.p 142 IWA 144
                          **7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.8E-2453143IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MVATKRLGDH SDSNSDDSLT RKRDDDVDAM RRKRKQLKTT TATLVPPSAS KIKWTKNDEL  60
VILGGIVDFE NETKLSYRSD RDALYHYIKD YVESNFSKRQ LIDKVRSLKR KFIDNQARSN  120
DGKELSFTDT DDDAIFKLSM MIWAKNETEH VGEDLNQAKD VPSGEQEIKN VSCAEQEQVS  180
VEVENGEKET LDQAKDVPCE EQEDMDVPCE EQEGKDVPCE EQERVSVEND NGEQEDMDVP  240
CEEQEGKDVP CEEKERVSVE NDNGEQEMSE EDGVGELGVM EDTLDSGITL LDSAKNGEKD  300
KSEEEGVYEL GVLQGILEGD TFYQNCGKFQ QKMLRQNLEK IGAEKRKQLI DEWNALMVEE  360
LKLYVKKLTF LAELLEMGEV SP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12034RKRDDDVDAMRRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294504.10.0hypothetical protein CARUB_v10023535mg
TrEMBLR0FWQ60.0R0FWQ6_9BRAS; Uncharacterized protein
STRINGAT2G36340.11e-155(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM124401528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36340.11e-158DNA-binding storekeeper protein-related transcriptional regulator