PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0228s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 439aa    MW: 46478.3 Da    PI: 9.6444
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0228s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.15.1e-15353401553
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                          +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN +Lk  l el+
  Cagra.0228s0013.1.p 353 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELE 401
                          79*****************************************999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-16349413IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.748351403IPR004827Basic-leucine zipper domain
CDDcd147073.79E-25353407No hitNo description
PfamPF001703.7E-13353401IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-14353402No hitNo description
SuperFamilySSF579591.69E-10353400No hitNo description
PROSITE patternPS000360356371IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MVLRETKMMS EREVESSTAQ GRPNGGGGES HHPFSSLGRQ SSIYSLTLDE FQHALCENGK  60
NFGSMNMDEF LVSIWNAEEN NNNQQTASHS LPPNHNGFNN NNNGGESGVG AFGGGSTANE  120
GANSSKRGIA KQPSLPRQGS LTLPAPLCRK TVDEVWSEIH RGGGGGSAAG DSNGRSSSSN  180
GQNNAQNGGE TAARQPTFGE MTLEDFLVKA GVVREHPTNP KANPNQNQNQ NPSSVIPAAA  240
QQQLYGVFQG AGDPTFPGQG MGVGDPSGYG KRTGGGGYQQ APPVQAGVCY GGGGGFGAGG  300
QQMGMVGPLS PVSSDGLGHG QVDNIGGQYG VDMGGLRGRK RVADGPVEKV VERRQRRMIK  360
NRESAARSRA RKQAYTVELE AELNQLKEEN AQLKHALAEL ERKRKQQYFE SLKTRAQPKL  420
PKPNGRLRTL MRNPSCPL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0265170.0BT026517.1 Arabidopsis thaliana At2g36270 mRNA, complete cds.
GenBankAF3342060.0AF334206.1 Arabidopsis thaliana bZIP protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296104.10.0hypothetical protein CARUB_v10025255mg
SwissprotQ9SJN00.0ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLR0G0V30.0R0G0V3_9BRAS; Uncharacterized protein
STRINGAT2G36270.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM92012536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.10.0bZIP family protein