PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0133s0093.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family FAR1
Protein Properties Length: 214aa    MW: 24681.9 Da    PI: 7.5614
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0133s0093.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR194.31.5e-2947136191
                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                          +fY++YA+ +GF +r+++ ++s r+g++++r++vC+keg+r+ + ++ +++r++ra tr gCka ++vk+ek+gkw+vtk+++eHnH+l+
  Cagra.0133s0093.1.p  47 SFYDSYATVMGFVMRVDAFRRSMRDGTVVWRRLVCNKEGFRRLRPRR-SESRKPRAITREGCKALIVVKREKSGKWVVTKFVKEHNHPLS 135
                          5********************************************99.9***************************************98 PP

                 FAR1  91 p 91 
                          p
  Cagra.0133s0093.1.p 136 P 136
                          6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.7E-2847136IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MEEHSQPEEE EEMMESSDGK YIVTNETSPL VEPFIGMEFE SEASAKSFYD SYATVMGFVM  60
RVDAFRRSMR DGTVVWRRLV CNKEGFRRLR PRRSESRKPR AITREGCKAL IVVKREKSGK  120
WVVTKFVKEH NHPLSPNVGR SSQLSQTPDE KDAKIRELSA ELSRERKRCA ALQQQLDMVL  180
EEMEEHSNHL STNINNVIQS VREIESNTFT KPL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0133s0093.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0040310.0BT004031.1 Arabidopsis thaliana clone RAFL15-31-E07 (R20864) unknown protein (At3g07500) mRNA, complete cds.
GenBankBT0050830.0BT005083.1 Arabidopsis thaliana clone U20864 unknown protein (At3g07500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023642497.11e-155protein FAR1-RELATED SEQUENCE 5 isoform X3
TrEMBLR0G2U41e-140R0G2U4_9BRAS; Uncharacterized protein
STRINGCagra.0133s0093.1.p1e-157(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135242227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.11e-111FAR1 family protein