PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc11_g15350
Common NameGSCOC_T00038045001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family YABBY
Protein Properties Length: 172aa    MW: 18948.4 Da    PI: 6.7691
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc11_g15350genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY180.31.1e-5561632163
        YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkeelleelkveeenlksnvekeesasts 95 
                  ++ +  +q+CyvqC++C+til+v+vP++sl+ vvtvrCGhCtsllsvn++ as    +l a          ++ + +++v  +++++n   ++    +
  Cc11_g15350   6 HLLDLQGQICYVQCGYCTTILLVNVPYSSLSAVVTVRCGHCTSLLSVNMTRASflplHLFAP-------SDQSDQSTTQVCPQETDVNADDHKGLDMQ 96 
                  5677899*****************************************99888444333333.......33445566777777777777777777777 PP

        YABBY  96 vsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                  ++s+ +s+ ++ee   ++ +++PPekrqr+Psaynrfi eeiqr+ka nP ++h++afs aak  ++f
  Cc11_g15350  97 IPSHVVSSPDEEEGE-TQAINKPPEKRQRAPSAYNRFIGEEIQRLKAINPTMTHKQAFSRAAKSVSYF 163
                  888666655555544.6789*******************************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.9E-5211163IPR006780YABBY protein
SuperFamilySSF470952.69E-5112157IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MSTLNHLLDL QGQICYVQCG YCTTILLVNV PYSSLSAVVT VRCGHCTSLL SVNMTRASFL  60
PLHLFAPSDQ SDQSTTQVCP QETDVNADDH KGLDMQIPSH VVSSPDEEEG ETQAINKPPE  120
KRQRAPSAYN RFIGEEIQRL KAINPTMTHK QAFSRAAKSV SYFYNFVPGK V*
Functional Description ? help Back to Top
Source Description
UniProtEssential for the formation and the abaxial-adaxial asymmetric growth of the ovule outer integument. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:9093862, ECO:0000269|PubMed:9118807}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Autoinduction down-regulated by SUP in adaxial region of the ovule outer integument. Negatively and spatially regulated by HLL, ANT, BELL1, NZZ/SPL and SUP. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:12183381}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027099769.11e-116axial regulator YABBY 4
SwissprotQ9LDT38e-57YAB4_ARATH; Axial regulator YABBY 4
TrEMBLA0A068UY941e-125A0A068UY94_COFCA; Uncharacterized protein
STRINGVIT_01s0127g00330.t013e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23420.13e-59YABBY family protein
Publications ? help Back to Top
  1. Lora J,Hormaza JI,Herrero M
    Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT).
    New Phytol., 2015. 208(2): p. 584-95
    [PMID:25991552]
  2. Skinner DJ,Brown RH,Kuzoff RK,Gasser CS
    Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function.
    BMC Plant Biol., 2016. 16(1): p. 143
    [PMID:27350128]
  3. Simon MK,Skinner DJ,Gallagher TL,Gasser CS
    Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors.
    Genetics, 2017. 207(4): p. 1489-1500
    [PMID:28971961]