PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc11_g13540
Common NameGSCOC_T00032169001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family HD-ZIP
Protein Properties Length: 324aa    MW: 36521.2 Da    PI: 4.6569
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc11_g13540genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.7e-1987140356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k++++t+eq++ Le+ Fe +++++ e++ +LAk l+L+ rqV +WFqNrRa++k
  Cc11_g13540  87 KKRRLTAEQVQFLERSFELENKLDPERKVQLAKDLSLQPRQVAIWFQNRRARYK 140
                  56789************************************************9 PP

2HD-ZIP_I/II127.74.9e-4186178193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl++eqv++LE+sFe e+kL+perKv+la++L lqprqva+WFqnrRAR+ktkqlEk+y+ Lk++yd+l+++ ++L ke+e+L++e+++
  Cc11_g13540  86 EKKRRLTAEQVQFLERSFELENKLDPERKVQLAKDLSLQPRQVAIWFQNRRARYKTKQLEKEYDCLKSSYDKLRADYDTLFKENESLKNEVHS 178
                  69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.41E-1970144IPR009057Homeodomain-like
PROSITE profilePS5007117.45982142IPR001356Homeobox domain
SMARTSM003892.3E-1885146IPR001356Homeobox domain
PfamPF000463.7E-1687140IPR001356Homeobox domain
CDDcd000864.43E-1787143No hitNo description
Gene3DG3DSA:1.10.10.604.1E-1988149IPR009057Homeodomain-like
PROSITE patternPS000270117140IPR017970Homeobox, conserved site
PfamPF021831.6E-16142183IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MEGCGGNITG TSSVLLQNER LPCSSHEALD SLWISNSSPP PFHGSTSMVK FGDARGENTR  60
EKTFFAQSDK GYDGSESYDN CFHQPEKKRR LTAEQVQFLE RSFELENKLD PERKVQLAKD  120
LSLQPRQVAI WFQNRRARYK TKQLEKEYDC LKSSYDKLRA DYDTLFKENE SLKNEVHSLA  180
EKLVQRERGK AKSEPLDSST ISPLNAEPQK ANPIALSPNV PEMPVSVKQE DASSAKSDVF  240
DSDSSHCTDG NHSSLMVPDD SSHVFEPELS DFSQDEDDSL SRSLLQPTGF PPKLEYECYN  300
DLQCNSGNLG FSVEDQSTWF WAY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134142RRARYKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027097765.10.0homeobox-leucine zipper protein HAT5-like
TrEMBLA0A068TVH70.0A0A068TVH7_COFCA; Uncharacterized protein
STRINGXP_009766848.11e-116(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-45homeobox 1